COX8C (cytochrome c oxidase subunit 8C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 341947
Gene name Cytochrome c oxidase subunit 8C
Gene symbol COX8C
Synonyms (NCBI Gene)
COX8-3
Chromosome 14
Chromosome location 14q32.12
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT021717 hsa-miR-132-3p Microarray 17612493
MIRT2447505 hsa-miR-4711-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 12762575
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616855 24382 ENSG00000187581
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z4L0
Protein name Cytochrome c oxidase subunit 8C, mitochondrial (Cytochrome c oxidase polypeptide 8 isoform 3) (Cytochrome c oxidase polypeptide VIII isoform 3) (COX VIII-3) (Cytochrome c oxidase subunit 8-3) (COX8-3) (Cytochrome c oxidase subunit VIIIC)
Protein function Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02285 COX8 29 → 72 Cytochrome oxidase c subunit VIII Family
Tissue specificity TISSUE SPECIFICITY: It is not yet known where COX8C is expressed.
Sequence 
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA
YVLGNLKQFRRN
Sequence length 72
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
Sort by:
COX6B2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX6A2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7A1 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7A2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7B2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction.
Cytochrome c oxidase deficiency Linked via 1 of 5 related genesCOX6A2 Mitochondrial complex deficiency Linked via 1 of 5 related genesCOX6A2 Mitochondrial disease Linked via 1 of 5 related genesCOX6A2 Asthma Linked via 1 of 5 related genesCOX7A2 Alzheimer disease Linked via 1 of 5 related genesCOX7B2