CNTN5 (contactin 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 53942
• Gene name: Contactin 5
• Gene symbol: CNTN5
• Synonyms (NCBI Gene): HNB-2s, NB-2
• Chromosome: 11
• Chromosome location: 11q22.1
• Summary: The protein encoded by this gene is a member of the immunoglobulin superfamily, and contactin family, which mediate cell surface interactions during nervous system development. This protein is a glycosylphosphatidylinositol (GPI)-anchored neuronal membran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT901721	hsa-miR-3149	CLIP-seq
MIRT901722	hsa-miR-494	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007420	Process	Brain development	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098632	Function	Cell-cell adhesion mediator activity	IBA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099054	Process	Presynapse assembly	IEA

Other IDs

• MIM: 607219
• HGNC: 2175
• e!Ensembl: ENSG00000149972

Protein

• UniProt ID: O94779
• Protein name: Contactin-5 (Neural recognition molecule NB-2) (hNB-2)
• Protein function: Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Probably involved in neuronal activity in the auditory
• PDB: 4N68 , 5E52
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	877 → 962	Fibronectin type III domain	Domain
  PF00041	fn3	672 → 760	Fibronectin type III domain	Domain
  PF07679	I-set	482 → 568	Immunoglobulin I-set domain	Domain
  PF07679	I-set	390 → 475	Immunoglobulin I-set domain	Domain
  PF07679	I-set	300 → 386	Immunoglobulin I-set domain	Domain
  PF07679	I-set	572 → 667	Immunoglobulin I-set domain	Domain
  PF13895	Ig_2	104 → 191	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and kidney and at very low level in placenta. Not expressed in other tissues. In brain, it is highly expressed in the occipital lobe, amygdala, cerebral cortex, frontal lobe, thalamus and temporal lobe. Expressed at
• Sequence:

  MASSWKLMLFLSVTMCLSEYSKSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLG
  TLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDIIFPTDSDEKKVA
  LNCEVRGNPVPSYRWLRNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATNTVG
  SILSREATLQFAYLGNFSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVA
  EDSRRFISQETGNLYISKVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEP
  KIEVHFPFTVTAAKGTTVKMECFALGNPVPTITWMKVNGYIPSKARLRKSQAVLEIPNVQ
  LDDAGIYECRAENSRGKNSFRGQLQVYTYPHWVEKLNDTQLDSGSPLRWECKATGKPRPT
  YRWLKNGVPLSPQSRVEMVNGVLMIHNVNQSDAGMYQCLAENKYGAIYASAELKILASAP
  TFALNQLKKTIIVTKDQEVVIECKPQGSPKPTISWKKGDRAVRENKRIAILPDGSLRILN
  ASKSDEGKYVCRGENVFGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDAS
  LDVTFYWTLKGQPIDFEEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVS
  DEAELLVRGPPGPPGIVIVEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVK
  TVPEIITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTNV
  SGRSGRRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDES
  VPPLTPFEVKVGVYNNKGDGPFSQIVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIK
  ESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGP
  PSSEVSATTKKSPPSQAPSNLRWEQQGSQVSLGWEPVIPLANESEVVGYKVFYRQEGHSN
  SQVIETQKLQAVVPLPDAGVYIIEVRAYSEGGDGTASSQIRVPSYSGGKITSAQSTLHSL
  STSSSSVTLLLALMIPSTSW

• Sequence length: 1100

Pathways

Reactome Pathway:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (42)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANXIETY DISORDER	—	GWAS catalog	39294497	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	17903304	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	38182794	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	27548383	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	20889312, 31926635, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRCADIAN RHYTHM SLEEP DISORDER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	20708005	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CNTN5-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CNTN5-related Neurodevelopmental disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32514122, 34671089, 38589358, 38872215	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CARCINOMA	—	GWAS catalog	38589358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	30801121	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM INFECTIOUS DISORDER	—	GWAS catalog	32152699	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31289104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease, susceptibility to, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	31289104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	34031191	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	27089181, 29942085, 30643256, 31926635, 31969693, 32606422, 38177345, 41233554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	20889312	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	27089181, 29292387, 29942085, 30595370, 30643256, 36244801	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	20708005	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERNICIOUS ANEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	20889312	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENIC DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	32438682, 36777996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (35)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	20558387, 23577068	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	28064060		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	31289104		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	17903304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	17903304	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27166760	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	30747104	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28064060		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27166760, 32807774, 39887962, 40483526	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21832240, 27166760, 28064060, 28346043		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	27166760, 30747104	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	27548383		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27548383	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28064060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17903304, 33441605	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17903304		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24707144	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32681239	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	23015367		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	31289104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	17903304	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17903304		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	19300444		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	19300444		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29264679		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28064060		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27089181, 29317604, 29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28064060, 28346043		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29264679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	26864383		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	23000144		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28064060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	17903304	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	27089181		★☆☆☆☆ Found in Text Mining only
X-linked hydrocephalus syndrome	Hydrocephalus Syndrome, X-Linked	BEFREE	19300444		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

B3GALT1 2 shared diseasesDiabetic ketoacidosis, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Diabetic ketoacidosis), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Diabetic ketoacidosis, Psychiatric disorders — evidence mostly GWAS catalog. ZSCAN12 2 shared diseasesAnxiety disorder, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Anxiety disorder, Psychiatric disorders — evidence mostly GWAS catalog. FAM53A 2 shared diseasesHyperuricemia, Large artery stroke 2 shared evidence sourcesGWAS catalog (Hyperuricemia), GWAS catalog (Large artery stroke) Related via 2 shared diseases including Hyperuricemia, Large artery stroke — evidence mostly GWAS catalog. SLC17A2 2 shared diseasesLiver cirrhosis, Large artery stroke 3 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Large artery stroke), GWAS catalog (Nonalcoholic fatty liver disease) Related via 2 shared diseases including Liver cirrhosis, Large artery stroke — evidence mostly GWAS catalog. SORCS3 3 shared diseasesAnxiety disorder, Behcet disease, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Behcet disease), GWAS catalog (Psychiatric disorders) Related via 3 shared diseases including Anxiety disorder, Behcet disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
B3GALT1	2	["Diabetic ketoacidosis","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Diabetic ketoacidosis)","GWAS catalog (Psychiatric disorders)"]
ZSCAN12	2	["Anxiety disorder","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Psychiatric disorders)"]
FAM53A	2	["Hyperuricemia","Large artery stroke"]	0	[]	2	["GWAS catalog (Hyperuricemia)","GWAS catalog (Large artery stroke)"]
SLC17A2	2	["Liver cirrhosis","Large artery stroke"]	0	[]	3	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Large artery stroke)","GWAS catalog (Nonalcoholic fatty liver disease)"]
SORCS3	3	["Anxiety disorder","Behcet disease","Psychiatric disorders"]	0	[]	3	["GWAS catalog (Anxiety disorder)","GWAS catalog (Behcet disease)","GWAS catalog (Psychiatric disorders)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesB3GALT1, ZSCAN12, SORCS3 Diabetes mellitus type 2 Linked via 2 of 5 related genesB3GALT1, SORCS3 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesZSCAN12, SORCS3 Autism Linked via 2 of 5 related genesZSCAN12, SORCS3 Breast cancer Linked via 2 of 5 related genesZSCAN12, SORCS3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["B3GALT1","ZSCAN12","SORCS3"]
Diabetes mellitus type 2	2	["B3GALT1","SORCS3"]
Attention deficit hyperactivity disorder	2	["ZSCAN12","SORCS3"]
Autism	2	["ZSCAN12","SORCS3"]
Breast cancer	2	["ZSCAN12","SORCS3"]