ZSCAN12 (zinc finger and SCAN domain containing 12)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9753
• Gene name: Zinc finger and SCAN domain containing 12
• Gene symbol: ZSCAN12
• Synonyms (NCBI Gene): ZFP96, ZNF29K1, ZNF305, ZNF96, dJ29K1.2
• Chromosome: 6
• Chromosome location: 6p22.1

miRNA Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028303	hsa-miR-32-5p	Sequencing	20371350
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT544414	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544413	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544412	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544411	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544410	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544409	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544408	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT317365	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT544407	hsa-miR-4311	PAR-CLIP	21572407
MIRT544406	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028303	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544405	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544404	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544403	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544402	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544401	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT544400	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT544399	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT544398	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544397	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT1543521	hsa-miR-3117-3p	CLIP-seq
MIRT1543522	hsa-miR-3155	CLIP-seq
MIRT1543523	hsa-miR-3155b	CLIP-seq
MIRT1543524	hsa-miR-3162-5p	CLIP-seq
MIRT1543525	hsa-miR-3169	CLIP-seq
MIRT1543526	hsa-miR-3942-3p	CLIP-seq
MIRT1543527	hsa-miR-4481	CLIP-seq
MIRT1543528	hsa-miR-4654	CLIP-seq
MIRT1543529	hsa-miR-4745-5p	CLIP-seq
MIRT1543530	hsa-miR-4758-5p	CLIP-seq
MIRT1543531	hsa-miR-4759	CLIP-seq
MIRT1543532	hsa-miR-4769-5p	CLIP-seq
MIRT1543533	hsa-miR-484	CLIP-seq
MIRT1543534	hsa-miR-563	CLIP-seq
MIRT1543535	hsa-miR-579	CLIP-seq
MIRT1543536	hsa-miR-659	CLIP-seq
MIRT1543537	hsa-miR-664	CLIP-seq
MIRT1543538	hsa-miR-892a	CLIP-seq
MIRT2383168	hsa-miR-1245b-5p	CLIP-seq
MIRT2383169	hsa-miR-3142	CLIP-seq
MIRT2383170	hsa-miR-335	CLIP-seq
MIRT2383171	hsa-miR-4277	CLIP-seq
MIRT2383172	hsa-miR-513c	CLIP-seq
MIRT2383173	hsa-miR-514b-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 603978
• HGNC: 13172
• e!Ensembl: ENSG00000158691

Protein

• UniProt ID: O43309
• Protein name: Zinc finger and SCAN domain-containing protein 12 (Zinc finger protein 305) (Zinc finger protein 96)
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	330 → 352	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	497 → 519	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	442 → 463	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	274 → 296	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	414 → 437	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	358 → 380	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	469 → 491	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	386 → 408	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	302 → 324	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	525 → 547	Zinc finger, C2H2 type	Domain
  PF02023	SCAN	42 → 131	SCAN domain	Domain

• Sequence:

  MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGP
  REALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTV
  LEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQ
  EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACS
  REDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR
  PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHC
  NDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG
  KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQ
  RTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSL
  IQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCF
  RRDL

• Sequence length: 604

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (16)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	36672180	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	39294497	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	33479212	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	33479212	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	33479212	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37467357	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	33909500	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	37467357	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29662059, 30643256, 33479212, 34045744, 34634379, 35898629, 36672180, 37464041, 37985818	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	33479212	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	37377963	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	26651848	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33479212, 37467357	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	37377963	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28167242		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28167242		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36001862	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28167242		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32332753	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	GWASCAT_DG	26651848		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31425724		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35039565	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

KCNK9 2 shared diseasesAnxiety disorder, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Anxiety disorder, Psychiatric disorders — evidence mostly GWAS catalog. COL22A1 2 shared diseasesAnxiety disorder, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Anxiety disorder, Psychiatric disorders — evidence mostly GWAS catalog. TMPRSS5 2 shared diseasesAnxiety disorder, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Anxiety disorder, Psychiatric disorders — evidence mostly GWAS catalog. HLA-DMB 2 shared diseasesEstrogen-receptor negative breast cancer, Sarcoidosis 2 shared evidence sourcesGWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Sarcoidosis) Related via 2 shared diseases including Estrogen-receptor negative breast cancer, Sarcoidosis — evidence mostly GWAS catalog. PAX5 2 shared diseasesAnxiety disorder, Estrogen-receptor negative breast cancer 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Estrogen-receptor negative breast cancer) Related via 2 shared diseases including Anxiety disorder, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
KCNK9	2	["Anxiety disorder","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Psychiatric disorders)"]
COL22A1	2	["Anxiety disorder","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Psychiatric disorders)"]
TMPRSS5	2	["Anxiety disorder","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Psychiatric disorders)"]
HLA-DMB	2	["Estrogen-receptor negative breast cancer","Sarcoidosis"]	0	[]	2	["GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Sarcoidosis)"]
PAX5	2	["Anxiety disorder","Estrogen-receptor negative breast cancer"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Estrogen-receptor negative breast cancer)"]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 3 of 5 related genesKCNK9, COL22A1, TMPRSS5 Colorectal cancer Linked via 3 of 5 related genesKCNK9, COL22A1, HLA-DMB Obesity Linked via 3 of 5 related genesKCNK9, COL22A1, PAX5 Dementia Linked via 2 of 5 related genesKCNK9, COL22A1 Mood disorder Linked via 2 of 5 related genesKCNK9, TMPRSS5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	3	["KCNK9","COL22A1","TMPRSS5"]
Colorectal cancer	3	["KCNK9","COL22A1","HLA-DMB"]
Obesity	3	["KCNK9","COL22A1","PAX5"]
Dementia	2	["KCNK9","COL22A1"]
Mood disorder	2	["KCNK9","TMPRSS5"]