Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	29082
Gene name	Charged multivesicular body protein 4A
Gene symbol	CHMP4A
Synonyms (NCBI Gene)	C14orf123CHMP4CHMP4BHSPC134SHAX2SNF7SNF7-1VPS32-1VPS32AhSnf7-1
Chromosome	14
Chromosome location	14q12
Summary	CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor p

17 Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT738208	hsa-miR-4505	HITS-CLIP	33718276
MIRT738209	hsa-miR-762	HITS-CLIP	33718276
MIRT738210	hsa-miR-4492	HITS-CLIP	33718276
MIRT738218	hsa-miR-1237	HITS-CLIP	33718276
MIRT890717	hsa-miR-1207-5p	CLIP-seq
MIRT890718	hsa-miR-1271	CLIP-seq
MIRT890719	hsa-miR-3065-3p	CLIP-seq
MIRT890720	hsa-miR-3614-5p	CLIP-seq
MIRT890721	hsa-miR-4477b	CLIP-seq
MIRT890722	hsa-miR-4514	CLIP-seq
MIRT890723	hsa-miR-4692	CLIP-seq
MIRT890724	hsa-miR-4763-3p	CLIP-seq
MIRT890725	hsa-miR-940	CLIP-seq
MIRT890726	hsa-miR-96	CLIP-seq
MIRT890718	hsa-miR-1271	CLIP-seq
MIRT890721	hsa-miR-4477b	CLIP-seq
MIRT890726	hsa-miR-96	CLIP-seq

86 Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IDA	17984323
GO:0000776	Component	Kinetochore	IDA	26040712
GO:0000776	Component	Kinetochore	IEA
GO:0000815	Component	ESCRT III complex	IBA
GO:0000815	Component	ESCRT III complex	IDA	18209100, 21975012, 24878737
GO:0000815	Component	ESCRT III complex	NAS	36107470
GO:0000815	Component	ESCRT III complex	TAS	20588296
GO:0001778	Process	Plasma membrane repair	IDA	24482116
GO:0001778	Process	Plasma membrane repair	IEA
GO:0005515	Function	Protein binding	IPI	14505570, 14519844, 16189514, 16730941, 17350572, 18511562, 18641129, 21975012, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	21975012
GO:0005643	Component	Nuclear pore	IDA	26040713
GO:0005643	Component	Nuclear pore	IEA
GO:0005737	Component	Cytoplasm	IDA	21975012, 24878737
GO:0005765	Component	Lysosomal membrane	IDA	17984323
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IDA	24878737
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IBA
GO:0005828	Component	Kinetochore microtubule	IDA	26040712
GO:0005828	Component	Kinetochore microtubule	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	24878737
GO:0005886	Component	Plasma membrane	IDA	24878737
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IMP	21975012
GO:0006900	Process	Vesicle budding from membrane	IBA
GO:0006900	Process	Vesicle budding from membrane	IGI	18209100
GO:0006900	Process	Vesicle budding from membrane	IMP	18209100
GO:0006914	Process	Autophagy	IMP	17984323
GO:0006997	Process	Nucleus organization	IMP	20616062
GO:0007034	Process	Vacuolar transport	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	20616062
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	18209100
GO:0010324	Process	Membrane invagination	IMP	24878737
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	TAS	20588296
GO:0030117	Component	Membrane coat	IMP	24878737
GO:0030496	Component	Midbody	IDA	22724069, 26040712
GO:0030496	Component	Midbody	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031468	Process	Nuclear membrane reassembly	IEA
GO:0031468	Process	Nuclear membrane reassembly	IMP	26040713
GO:0031902	Component	Late endosome membrane	IEA
GO:0032511	Process	Late endosome to vacuole transport via multivesicular body sorting pathway	IBA
GO:0032585	Component	Multivesicular body membrane	IDA	16554368
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0036258	Process	Multivesicular body assembly	IEA
GO:0036258	Process	Multivesicular body assembly	NAS	16505166
GO:0036258	Process	Multivesicular body assembly	TAS	20588296
GO:0039702	Process	Viral budding via host ESCRT complex	IDA	24878737
GO:0039702	Process	Viral budding via host ESCRT complex	IEA
GO:0039702	Process	Viral budding via host ESCRT complex	IGI	24107264
GO:0039702	Process	Viral budding via host ESCRT complex	TAS	20588296
GO:0042802	Function	Identical protein binding	IPI	18209100
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	14519844
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IDA	17984323
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA
GO:0046761	Process	Viral budding from plasma membrane	IDA	24878737
GO:0046761	Process	Viral budding from plasma membrane	IEA
GO:0050877	Process	Nervous system process	IMP	21975012
GO:0051117	Function	ATPase binding	IPI	18209100
GO:0051258	Process	Protein polymerization	IMP	18209100, 24878737
GO:0051469	Process	Vesicle fusion with vacuole	NAS	16505166
GO:0061763	Process	Multivesicular body-lysosome fusion	NAS	16505166
GO:0061952	Process	Midbody abscission	IEA
GO:0061952	Process	Midbody abscission	IMP	20616062
GO:0071985	Process	Multivesicular body sorting pathway	IDA	16554368
GO:0071985	Process	Multivesicular body sorting pathway	IEA
GO:0071985	Process	Multivesicular body sorting pathway	IMP	21975012
GO:0090148	Process	Membrane fission	NAS	19234443
GO:0097320	Process	Plasma membrane tubulation	IGI	18209100
GO:0097320	Process	Plasma membrane tubulation	IMP	18209100
GO:0097352	Process	Autophagosome maturation	IEA
GO:0097352	Process	Autophagosome maturation	IMP	17984323
GO:1901673	Process	Regulation of mitotic spindle assembly	IEA
GO:1901673	Process	Regulation of mitotic spindle assembly	IMP	20616062
GO:1902774	Process	Late endosome to lysosome transport	IEA
GO:1902774	Process	Late endosome to lysosome transport	IMP	17984323
GO:1904930	Component	Amphisome membrane	IDA	17984323
GO:1904930	Component	Amphisome membrane	IEA

MIM	HGNC	e!Ensembl
610051	20274	ENSG00000254505

Q9BY43

Protein name

Charged multivesicular body protein 4a (Chromatin-modifying protein 4a) (CHMP4a) (SNF7 homolog associated with Alix-2) (SNF7-1) (hSnf-1) (Vacuolar protein sorting-associated protein 32-1) (Vps32-1) (hVps32-1)

Protein function

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (IL

PDB

3C3O , 5MK1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03357	Snf7	21 → 199	Snf7	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in heart, kidney, liver and skeletal muscle. Also expressed in brain, placenta, lung and pancreas. {ECO:0000269|PubMed:14678797}.

Sequence

MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS

Sequence length

222

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	Budding and maturation of HIV virion
Virion - Hepatitis viruses	Macroautophagy
Endocytosis	Endosomal Sorting Complex Required For Transport (ESCRT)
Necroptosis	HCMV Late Events
	Sealing of the nuclear envelope (NE) by ESCRT-III

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
CHMP4B	[]	9	["Viral life cycle - HIV-1","Virion - Hepatitis viruses","Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
VPS4A	[]	8	["Viral life cycle - HIV-1","Virion - Hepatitis viruses","Endocytosis","Necroptosis","Budding and maturation of HIV virion","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP6	[]	8	["Viral life cycle - HIV-1","Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP7	[]	8	["Virion - Hepatitis viruses","Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
RNF103-CHMP3	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]

CHMP4A (charged multivesicular body protein 4A)

Bookmark This Gene