CGAS (cyclic GMP-AMP synthase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 115004
• Gene name: Cyclic GMP-AMP synthase
• Gene symbol: CGAS
• Synonyms (NCBI Gene): C6orf150, D4, MB21D1, h-cGAS
• Chromosome: 6
• Chromosome location: 6q13

Gene ontology (GO) Show/Hide all (102)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002218	Process	Activation of innate immune response	IBA
GO:0002218	Process	Activation of innate immune response	IDA	23258413, 23929945, 24077100, 26046437, 28363908, 29426904, 30007416, 32817552, 32911482, 32912999, 33542149, 35438208
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002218	Process	Activation of innate immune response	IMP	23258413
GO:0002221	Process	Pattern recognition receptor signaling pathway	IDA	23258413
GO:0002230	Process	Positive regulation of defense response to virus by host	IBA
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	23929945, 24077100, 26046437
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	23258413
GO:0002376	Process	Immune system process	IEA
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	23258413
GO:0003677	Function	DNA binding	IDA	23258413
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	28738408, 32817552, 32911482, 32912999, 33051594, 33542149
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IDA	24077100, 28363908, 29937271, 30007416, 32792394, 32817552, 32911482, 32912999, 33051594, 33542149, 35438208, 35460603
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	TAS	37403426
GO:0005515	Function	Protein binding	IPI	26046437, 30135424, 30356214, 30510222, 35322803
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	30827685
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	38418882
GO:0005634	Component	Nucleus	IDA	29937271, 30356214, 31544964, 32792394, 33230297, 33406424
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	23258413
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	32912999, 35438208
GO:0005829	Component	Cytosol	IDA	23258413, 29937271, 30356214, 30827685, 31544964, 32792394, 33406424
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	37403426
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	30827685
GO:0005886	Component	Plasma membrane	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	28738408
GO:0006974	Process	DNA damage response	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019933	Process	CAMP-mediated signaling	IDA	23258413, 24077100
GO:0019934	Process	CGMP-mediated signaling	IDA	23258413, 24077100
GO:0023019	Process	Signal transduction involved in regulation of gene expression	TAS	37403426
GO:0031491	Function	Nucleosome binding	IDA	32911482, 32912999, 33051594
GO:0031491	Function	Nucleosome binding	IEA
GO:0032479	Process	Regulation of type I interferon production	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IBA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0032481	Process	Positive regulation of type I interferon production	IDA	24077100, 26046437, 28363908, 28738408, 32792394, 33230297, 33406424
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0035861	Component	Site of double-strand break	IBA
GO:0035861	Component	Site of double-strand break	IDA	30356214
GO:0038001	Process	Paracrine signaling	IBA
GO:0038001	Process	Paracrine signaling	IDA	24077100
GO:0038001	Process	Paracrine signaling	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	29426904, 32911482, 32912999, 33051594, 33542149, 35438208
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	TAS	37403426
GO:0045087	Process	Innate immune response	TAS	37403426
GO:0045738	Process	Negative regulation of DNA repair	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0051607	Process	Defense response to virus	IDA	21478870, 23929945, 24077100, 26046437
GO:0051607	Process	Defense response to virus	IEA
GO:0061501	Function	2',3'-cyclic GMP-AMP synthase activity	EXP	23258412
GO:0061501	Function	2',3'-cyclic GMP-AMP synthase activity	IBA
GO:0061501	Function	2',3'-cyclic GMP-AMP synthase activity	IDA	23258413, 24077100, 26300263, 28214358, 28363908, 28738408, 28934246, 29426904, 29937271, 30007416, 32792394, 32911482, 32912999, 33542149
GO:0061501	Function	2',3'-cyclic GMP-AMP synthase activity	IEA
GO:0061501	Function	2',3'-cyclic GMP-AMP synthase activity	TAS	37403426
GO:0071360	Process	Cellular response to exogenous dsRNA	IBA
GO:0071360	Process	Cellular response to exogenous dsRNA	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	32911482, 32912999, 35322803, 39322678
GO:0140693	Function	Molecular condensate scaffold activity	IEA
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800, 30842659, 30842662, 32911482, 32912999, 33542149
GO:0140896	Process	CGAS/STING signaling pathway	IDA	32911482, 32912999, 33542149, 35322803, 35438208, 35460603, 39322678
GO:0140896	Process	CGAS/STING signaling pathway	IEA
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0160004	Function	Poly-ADP-D-ribose modification-dependent protein binding	IEA
GO:0160004	Function	Poly-ADP-D-ribose modification-dependent protein binding	ISS
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	32911482, 32912999
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	TAS	37403426
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IBA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	30356214, 31544964
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IEA
GO:2000774	Process	Positive regulation of cellular senescence	ISS

Other IDs

• MIM: 613973
• HGNC: 21367
• e!Ensembl: ENSG00000164430

Protein

• UniProt ID: Q8N884
• Protein name: Cyclic GMP-AMP synthase (cGAMP synthase) (cGAS) (h-cGAS) (EC 2.7.7.86) (2'3'-cGAMP synthase) (Mab-21 domain-containing protein 1)
• Protein function: Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (2',3'-cGAMP) from ATP and GTP and plays a key role in innate immunity (PubMed:21478870, PubMed:23258413, PubMed:23707061, PubMed:23707065, PubMed:23722159, PubMed:24077100, P
• PDB: 4KM5 , 4LEV , 4LEW , 4MKP , 4O67 , 4O68 , 4O69 , 5V8O , 5VDO , 5VDP , 5VDQ , 5VDR , 5VDS , 5VDT , 5VDU , 5VDV , 5VDW , 6CT9 , 6CTA , 6EDB , 6EDC , 6LRC , 6LRE , 6LRI , 6LRJ , 6LRK , 6LRL , 6MJU , 6MJW , 6MJX , 6NAO , 6NFG , 6NFO , 6O47 , 6Y5D , 6Y5E , 7C0M , 7CCQ , 7CCR , 7FTF , 7FTG , 7FTH , 7FTI , 7FTJ , 7FTK , 7FTL , 7FTM , 7FTN , 7FTO , 7FTP , 7FTQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03281	Mab-21	214 → 510	Mab-21 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the monocytic cell line THP1. {ECO:0000269|PubMed:23258413}.
• Sequence:

  MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
  QKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGS
  CRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDIS
  TAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLE
  EYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKR
  KRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLV
  PKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL
  KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKL
  ENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF

• Sequence length: 522

Pathways

KEGG Pathway	Reactome Pathway
Cytosolic DNA-sensing pathway	STING mediated induction of host immune responses
Shigellosis
Human cytomegalovirus infection
Herpes simplex virus 1 infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (72)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	29215161	Associate	★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	26223655, 27863149, 28963528		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37221295, 38049398, 39753133	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26819496, 37802125	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34459078	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36598778	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	36030554	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24813208, 26223655, 28363908, 28771599, 28835460, 28940468, 28963528, 30510222, 30799039, 30990921, 31066607, 31276766		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27125983, 33051594, 34718330, 37129502, 37802125	Associate	★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	28738408		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	30936263	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34728791	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35415876, 36061145, 36574362, 37586363, 37667220, 38200309, 38238314	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35983076, 37319163	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35931086	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	36923311, 37612508	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36165492	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34790819, 37108510, 38065948	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31439450, 31869529, 35749909, 37355491	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35429245	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	38466010	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	34016129	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	36030554, 36564154	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36139069	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34215848	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38238314	Associate	★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor x deficiency	Pubtator	31371933	Associate	★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	29176737		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36574362, 38214828	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36267817, 37027305, 37219874	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	40018947	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	37834346	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38200309	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	38498709	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34524912	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33476576	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36336725	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32546974	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	27933565		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31665638		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29871919		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30772497		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32602227	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	27863149		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29215161, 34718330, 37129502	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	27863149		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27863149, 28934246, 29806091		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	27863149		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31371933	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28073693, 28976970, 29156566, 30007416, 30356214, 30583098, 30673358, 31358977, 31544964, 31799772		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38239354	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35177088	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29106401, 29437120		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	36030554	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	36030554	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28088707, 28801234, 30356214, 30583098, 30790684		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34459078	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	38148453	Associate	★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	10331118		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31068249	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38373690	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35773436, 37330147, 37547756	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35657605	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	35983076	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38057852, 40532290	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	10331118		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35794238	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31391008, 32768338, 34625078, 35563740, 37834346	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34708125, 37328804, 39242811	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34583980, 37612508, 39967410	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34116604, 36923311	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	34010983	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

STING1 7 shared pathwaysCytosolic DNA-sensing pathway, Shigellosis, Human cytomegalovirus infection, Herpes simplex virus 1 infection, Human immunodeficiency virus 1 infection, Coronavirus disease - COVID-19, STING mediated induction of host immune responses Related via 7 shared pathways including Cytosolic DNA-sensing pathway, Shigellosis. TAPBP 3 shared pathwaysHuman cytomegalovirus infection, Herpes simplex virus 1 infection, Human immunodeficiency virus 1 infection Related via 3 shared pathways including Human cytomegalovirus infection, Herpes simplex virus 1 infection. TRAF5 4 shared pathwaysShigellosis, Human cytomegalovirus infection, Herpes simplex virus 1 infection, Human immunodeficiency virus 1 infection Related via 4 shared pathways including Shigellosis, Human cytomegalovirus infection. PDIA3 3 shared pathwaysHuman cytomegalovirus infection, Herpes simplex virus 1 infection, Human immunodeficiency virus 1 infection Related via 3 shared pathways including Human cytomegalovirus infection, Herpes simplex virus 1 infection. IFI16 2 shared pathwaysCytosolic DNA-sensing pathway, STING mediated induction of host immune responses Related via 2 shared pathways including Cytosolic DNA-sensing pathway, STING mediated induction of host immune responses.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
STING1	0	[]	7	["Cytosolic DNA-sensing pathway","Shigellosis","Human cytomegalovirus infection","Herpes simplex virus 1 infection","Human immunodeficiency virus 1 infection","Coronavirus disease - COVID-19","STING mediated induction of host immune responses"]	0	[]
TAPBP	0	[]	3	["Human cytomegalovirus infection","Herpes simplex virus 1 infection","Human immunodeficiency virus 1 infection"]	0	[]
TRAF5	0	[]	4	["Shigellosis","Human cytomegalovirus infection","Herpes simplex virus 1 infection","Human immunodeficiency virus 1 infection"]	0	[]
PDIA3	0	[]	3	["Human cytomegalovirus infection","Herpes simplex virus 1 infection","Human immunodeficiency virus 1 infection"]	0	[]
IFI16	0	[]	2	["Cytosolic DNA-sensing pathway","STING mediated induction of host immune responses"]	0	[]

Diseases Linked via Similar Genes

Autoinflammatory syndrome Linked via 1 of 5 related genesSTING1 Chilblain lupus erythematosus Linked via 1 of 5 related genesSTING1 Esophageal squamous cell carcinoma Linked via 1 of 5 related genesSTING1 Chilblain lupus Linked via 1 of 5 related genesSTING1 Lung cancer Linked via 1 of 5 related genesSTING1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autoinflammatory syndrome	1	["STING1"]
Chilblain lupus erythematosus	1	["STING1"]
Esophageal squamous cell carcinoma	1	["STING1"]
Chilblain lupus	1	["STING1"]
Lung cancer	1	["STING1"]