CENPL (centromere protein L)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 91687
• Gene name: Centromere protein L
• Gene symbol: CENPL
• Synonyms (NCBI Gene): C1orf155, CENP-L, dJ383J4.3
• Chromosome: 1
• Chromosome location: 1q25.1
• Summary: CENPL is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006) [PubMed 16622420].[sup

miRNA Show/Hide all (227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT693632	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT693631	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT693630	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT693629	hsa-miR-8063	HITS-CLIP	23313552
MIRT693628	hsa-miR-4698	HITS-CLIP	23313552
MIRT693627	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT693626	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT693625	hsa-miR-4421	HITS-CLIP	23313552
MIRT693624	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT693623	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT693622	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT693621	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT693620	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT693619	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT693618	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT693617	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT693616	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT693615	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT693614	hsa-miR-612	HITS-CLIP	23313552
MIRT693613	hsa-miR-6860	HITS-CLIP	23313552
MIRT693612	hsa-miR-4725-5p	HITS-CLIP	23313552
MIRT693611	hsa-miR-661	HITS-CLIP	23313552
MIRT693610	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT693609	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT693608	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT646627	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT646626	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT646625	hsa-miR-3163	HITS-CLIP	23824327
MIRT646624	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT646623	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT646622	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT646621	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT646619	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT646620	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT646618	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT693632	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT693631	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT693630	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT693629	hsa-miR-8063	HITS-CLIP	23313552
MIRT693628	hsa-miR-4698	HITS-CLIP	23313552
MIRT693627	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT693626	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT693625	hsa-miR-4421	HITS-CLIP	23313552
MIRT693624	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT693623	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT693622	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT693621	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT693620	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT693619	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT693618	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT693617	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT693616	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT693615	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT693614	hsa-miR-612	HITS-CLIP	23313552
MIRT693613	hsa-miR-6860	HITS-CLIP	23313552
MIRT693612	hsa-miR-4725-5p	HITS-CLIP	23313552
MIRT693611	hsa-miR-661	HITS-CLIP	23313552
MIRT693610	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT693609	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT693608	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT646627	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT646626	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT646625	hsa-miR-3163	HITS-CLIP	23824327
MIRT646624	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT646623	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT646622	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT646621	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT646619	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT646620	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT646618	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT884988	hsa-miR-1202	CLIP-seq
MIRT884989	hsa-miR-1290	CLIP-seq
MIRT884990	hsa-miR-197	CLIP-seq
MIRT884991	hsa-miR-199a-3p	CLIP-seq
MIRT884992	hsa-miR-199b-3p	CLIP-seq
MIRT884993	hsa-miR-3123	CLIP-seq
MIRT884994	hsa-miR-3129-5p	CLIP-seq
MIRT884995	hsa-miR-3154	CLIP-seq
MIRT884996	hsa-miR-3179	CLIP-seq
MIRT884997	hsa-miR-3184	CLIP-seq
MIRT884998	hsa-miR-3925-5p	CLIP-seq
MIRT884999	hsa-miR-3936	CLIP-seq
MIRT885000	hsa-miR-3972	CLIP-seq
MIRT885001	hsa-miR-423-5p	CLIP-seq
MIRT885002	hsa-miR-4277	CLIP-seq
MIRT885003	hsa-miR-4450	CLIP-seq
MIRT885004	hsa-miR-4716-5p	CLIP-seq
MIRT885005	hsa-miR-4781-3p	CLIP-seq
MIRT885006	hsa-miR-5096	CLIP-seq
MIRT885007	hsa-miR-936	CLIP-seq
MIRT885008	hsa-miR-105	CLIP-seq
MIRT884988	hsa-miR-1202	CLIP-seq
MIRT884989	hsa-miR-1290	CLIP-seq
MIRT885009	hsa-miR-129-5p	CLIP-seq
MIRT885010	hsa-miR-1304	CLIP-seq
MIRT885011	hsa-miR-1343	CLIP-seq
MIRT885012	hsa-miR-1827	CLIP-seq
MIRT885013	hsa-miR-3176	CLIP-seq
MIRT884997	hsa-miR-3184	CLIP-seq
MIRT885014	hsa-miR-3662	CLIP-seq
MIRT885015	hsa-miR-3663-5p	CLIP-seq
MIRT885016	hsa-miR-3922-3p	CLIP-seq
MIRT885000	hsa-miR-3972	CLIP-seq
MIRT885001	hsa-miR-423-5p	CLIP-seq
MIRT885002	hsa-miR-4277	CLIP-seq
MIRT885017	hsa-miR-4311	CLIP-seq
MIRT885018	hsa-miR-4427	CLIP-seq
MIRT885003	hsa-miR-4450	CLIP-seq
MIRT885019	hsa-miR-4452	CLIP-seq
MIRT885020	hsa-miR-4635	CLIP-seq
MIRT885021	hsa-miR-4680-3p	CLIP-seq
MIRT885022	hsa-miR-4720-3p	CLIP-seq
MIRT885023	hsa-miR-4757-5p	CLIP-seq
MIRT885024	hsa-miR-4762-3p	CLIP-seq
MIRT885025	hsa-miR-4804-3p	CLIP-seq
MIRT885026	hsa-miR-548m	CLIP-seq
MIRT885027	hsa-miR-640	CLIP-seq
MIRT1962457	hsa-miR-552	CLIP-seq
MIRT885008	hsa-miR-105	CLIP-seq
MIRT1962458	hsa-miR-1184	CLIP-seq
MIRT1962459	hsa-miR-122	CLIP-seq
MIRT885011	hsa-miR-1343	CLIP-seq
MIRT1962460	hsa-miR-24	CLIP-seq
MIRT1962461	hsa-miR-3135b	CLIP-seq
MIRT885013	hsa-miR-3176	CLIP-seq
MIRT1962462	hsa-miR-3652	CLIP-seq
MIRT885016	hsa-miR-3922-3p	CLIP-seq
MIRT1962463	hsa-miR-4284	CLIP-seq
MIRT1962464	hsa-miR-4418	CLIP-seq
MIRT1962465	hsa-miR-4423-5p	CLIP-seq
MIRT1962466	hsa-miR-4430	CLIP-seq
MIRT885019	hsa-miR-4452	CLIP-seq
MIRT885023	hsa-miR-4757-5p	CLIP-seq
MIRT1962467	hsa-miR-509-3-5p	CLIP-seq
MIRT1962468	hsa-miR-509-5p	CLIP-seq
MIRT885027	hsa-miR-640	CLIP-seq
MIRT2198855	hsa-miR-106a	CLIP-seq
MIRT2198856	hsa-miR-106b	CLIP-seq
MIRT1962458	hsa-miR-1184	CLIP-seq
MIRT2198857	hsa-miR-1287	CLIP-seq
MIRT2198858	hsa-miR-17	CLIP-seq
MIRT2198859	hsa-miR-20a	CLIP-seq
MIRT2198860	hsa-miR-20b	CLIP-seq
MIRT1962460	hsa-miR-24	CLIP-seq
MIRT2198861	hsa-miR-302a	CLIP-seq
MIRT2198862	hsa-miR-302b	CLIP-seq
MIRT2198863	hsa-miR-302c	CLIP-seq
MIRT2198864	hsa-miR-302d	CLIP-seq
MIRT2198865	hsa-miR-302e	CLIP-seq
MIRT1962461	hsa-miR-3135b	CLIP-seq
MIRT2198866	hsa-miR-372	CLIP-seq
MIRT2198867	hsa-miR-373	CLIP-seq
MIRT2198868	hsa-miR-3908	CLIP-seq
MIRT2198869	hsa-miR-3942-5p	CLIP-seq
MIRT1962463	hsa-miR-4284	CLIP-seq
MIRT2198870	hsa-miR-4291	CLIP-seq
MIRT2198871	hsa-miR-4310	CLIP-seq
MIRT1962464	hsa-miR-4418	CLIP-seq
MIRT2198872	hsa-miR-4423-3p	CLIP-seq
MIRT2198873	hsa-miR-4703-5p	CLIP-seq
MIRT2198874	hsa-miR-4753-3p	CLIP-seq
MIRT2198875	hsa-miR-4766-3p	CLIP-seq
MIRT1962467	hsa-miR-509-3-5p	CLIP-seq
MIRT1962468	hsa-miR-509-5p	CLIP-seq
MIRT2198876	hsa-miR-512-3p	CLIP-seq
MIRT2198877	hsa-miR-519d	CLIP-seq
MIRT2198878	hsa-miR-520a-3p	CLIP-seq
MIRT2198879	hsa-miR-520b	CLIP-seq
MIRT2198880	hsa-miR-520c-3p	CLIP-seq
MIRT2198881	hsa-miR-520d-3p	CLIP-seq
MIRT2198882	hsa-miR-520e	CLIP-seq
MIRT2198883	hsa-miR-520g	CLIP-seq
MIRT2198884	hsa-miR-520h	CLIP-seq
MIRT2198885	hsa-miR-93	CLIP-seq
MIRT2385937	hsa-miR-1976	CLIP-seq
MIRT2385938	hsa-miR-4279	CLIP-seq
MIRT2385939	hsa-miR-450b-3p	CLIP-seq
MIRT2385940	hsa-miR-455-5p	CLIP-seq
MIRT2385941	hsa-miR-4713-3p	CLIP-seq
MIRT2385942	hsa-miR-638	CLIP-seq
MIRT2385943	hsa-miR-769-3p	CLIP-seq
MIRT1962459	hsa-miR-122	CLIP-seq
MIRT885012	hsa-miR-1827	CLIP-seq
MIRT1962461	hsa-miR-3135b	CLIP-seq
MIRT1962462	hsa-miR-3652	CLIP-seq
MIRT1962465	hsa-miR-4423-5p	CLIP-seq
MIRT1962466	hsa-miR-4430	CLIP-seq
MIRT2501655	hsa-miR-4715-3p	CLIP-seq
MIRT1962458	hsa-miR-1184	CLIP-seq
MIRT1962459	hsa-miR-122	CLIP-seq
MIRT1962460	hsa-miR-24	CLIP-seq
MIRT1962461	hsa-miR-3135b	CLIP-seq
MIRT1962462	hsa-miR-3652	CLIP-seq
MIRT1962463	hsa-miR-4284	CLIP-seq
MIRT1962464	hsa-miR-4418	CLIP-seq
MIRT1962465	hsa-miR-4423-5p	CLIP-seq
MIRT1962466	hsa-miR-4430	CLIP-seq
MIRT2501655	hsa-miR-4715-3p	CLIP-seq
MIRT2501656	hsa-miR-4742-3p	CLIP-seq
MIRT2501657	hsa-miR-4803	CLIP-seq
MIRT1962467	hsa-miR-509-3-5p	CLIP-seq
MIRT1962468	hsa-miR-509-5p	CLIP-seq
MIRT1962458	hsa-miR-1184	CLIP-seq
MIRT1962459	hsa-miR-122	CLIP-seq
MIRT885012	hsa-miR-1827	CLIP-seq
MIRT884991	hsa-miR-199a-3p	CLIP-seq
MIRT884992	hsa-miR-199b-3p	CLIP-seq
MIRT1962460	hsa-miR-24	CLIP-seq
MIRT884993	hsa-miR-3123	CLIP-seq
MIRT884994	hsa-miR-3129-5p	CLIP-seq
MIRT1962461	hsa-miR-3135b	CLIP-seq
MIRT884995	hsa-miR-3154	CLIP-seq
MIRT884996	hsa-miR-3179	CLIP-seq
MIRT1962462	hsa-miR-3652	CLIP-seq
MIRT884998	hsa-miR-3925-5p	CLIP-seq
MIRT884999	hsa-miR-3936	CLIP-seq
MIRT1962463	hsa-miR-4284	CLIP-seq
MIRT1962464	hsa-miR-4418	CLIP-seq
MIRT1962465	hsa-miR-4423-5p	CLIP-seq
MIRT1962466	hsa-miR-4430	CLIP-seq
MIRT2501655	hsa-miR-4715-3p	CLIP-seq
MIRT2501656	hsa-miR-4742-3p	CLIP-seq
MIRT2501657	hsa-miR-4803	CLIP-seq
MIRT1962467	hsa-miR-509-3-5p	CLIP-seq
MIRT1962468	hsa-miR-509-5p	CLIP-seq
MIRT885007	hsa-miR-936	CLIP-seq
MIRT2678015	hsa-miR-944	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000939	Component	Inner kinetochore	IPI	36085283
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	36085283
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007059	Process	Chromosome segregation	NAS	36085283

Other IDs

• MIM: 611503
• HGNC: 17879
• e!Ensembl: ENSG00000120334

Protein

• UniProt ID: Q8N0S6
• Protein name: Centromere protein L (CENP-L) (Interphase centromere complex protein 33)
• Protein function: Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesiz
• PDB: 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13092	CENP-L	177 → 324	Kinetochore complex Sim4 subunit Fta1	Family

• Sequence:

  MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVD
  PQKVAFLLHKQWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVI
  FSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTC
  LPLFLANGAESNTAIIGTWFQKTFDCYFSPLAINAFNLSWMAAMWTACKMDHYVATTEFL
  WSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEVDLFMDCLYSHFHRHFKIHLS
  ATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE

• Sequence length: 344

Pathways

Reactome Pathway

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal

Separation of Sister Chromatids

Resolution of Sister Chromatid Cohesion

RHO GTPases Activate Formins

Deposition of new CENPA-containing nucleosomes at the centromere

Mitotic Prometaphase

EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Adrenocortical carcinoma, hereditary	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	34341433	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34457090, 34607313, 36572856, 37914022	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36572856	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36572856	Stimulate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	21548129	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36572856	Stimulate	★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	21548129	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36572856	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CENPA 7 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Deposition of new CENPA-containing nucleosomes at the centromere, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. CENPC 7 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Deposition of new CENPA-containing nucleosomes at the centromere, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. CENPI 7 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Deposition of new CENPA-containing nucleosomes at the centromere, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. CENPP 7 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Deposition of new CENPA-containing nucleosomes at the centromere, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. CENPQ 7 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Deposition of new CENPA-containing nucleosomes at the centromere, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 7 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CENPA	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPC	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPI	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPP	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPQ	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]

Diseases Linked via Similar Genes

Ankylosing spondylitis Linked via 1 of 5 related genesCENPA Hepatocellular carcinoma Linked via 1 of 5 related genesCENPA Color vision deficiency Linked via 1 of 5 related genesCENPC Crest syndrome Linked via 1 of 5 related genesCENPC Crst syndrome Linked via 1 of 5 related genesCENPC

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Ankylosing spondylitis	1	["CENPA"]
Hepatocellular carcinoma	1	["CENPA"]
Color vision deficiency	1	["CENPC"]
Crest syndrome	1	["CENPC"]
Crst syndrome	1	["CENPC"]