Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	401541
Gene name	Centromere protein P
Gene symbol	CENPP
Synonyms (NCBI Gene)	CENP-P
Chromosome	9
Chromosome location	9q22.31
Summary	CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[sup

287 Show/Hide all (287)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051416	hsa-let-7e-5p	CLASH	23622248
MIRT571038	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT571036	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT571037	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT571035	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT571033	hsa-miR-4319	PAR-CLIP	20371350
MIRT571034	hsa-miR-4324	PAR-CLIP	20371350
MIRT571032	hsa-miR-143-3p	PAR-CLIP	20371350
MIRT571031	hsa-miR-4770	PAR-CLIP	20371350
MIRT571030	hsa-miR-6088	PAR-CLIP	20371350
MIRT571029	hsa-miR-4708-5p	PAR-CLIP	20371350
MIRT571028	hsa-miR-1273f	PAR-CLIP	20371350
MIRT571026	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT571027	hsa-miR-210-5p	PAR-CLIP	20371350
MIRT571038	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT571036	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT571037	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT571035	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT571033	hsa-miR-4319	PAR-CLIP	20371350
MIRT571034	hsa-miR-4324	PAR-CLIP	20371350
MIRT571032	hsa-miR-143-3p	PAR-CLIP	20371350
MIRT571031	hsa-miR-4770	PAR-CLIP	20371350
MIRT571030	hsa-miR-6088	PAR-CLIP	20371350
MIRT571029	hsa-miR-4708-5p	PAR-CLIP	20371350
MIRT571028	hsa-miR-1273f	PAR-CLIP	20371350
MIRT571026	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT571027	hsa-miR-210-5p	PAR-CLIP	20371350
MIRT885307	hsa-let-7a	CLIP-seq
MIRT885308	hsa-let-7b	CLIP-seq
MIRT885309	hsa-let-7c	CLIP-seq
MIRT885310	hsa-let-7d	CLIP-seq
MIRT885311	hsa-let-7e	CLIP-seq
MIRT885312	hsa-let-7f	CLIP-seq
MIRT885313	hsa-let-7g	CLIP-seq
MIRT885314	hsa-let-7i	CLIP-seq
MIRT885315	hsa-miR-1197	CLIP-seq
MIRT885316	hsa-miR-1224-5p	CLIP-seq
MIRT885317	hsa-miR-1294	CLIP-seq
MIRT885318	hsa-miR-1297	CLIP-seq
MIRT885319	hsa-miR-1343	CLIP-seq
MIRT885320	hsa-miR-143	CLIP-seq
MIRT885321	hsa-miR-196a	CLIP-seq
MIRT885322	hsa-miR-196b	CLIP-seq
MIRT885323	hsa-miR-19a	CLIP-seq
MIRT885324	hsa-miR-19b	CLIP-seq
MIRT885325	hsa-miR-23a	CLIP-seq
MIRT885326	hsa-miR-23b	CLIP-seq
MIRT885327	hsa-miR-23c	CLIP-seq
MIRT885328	hsa-miR-26a	CLIP-seq
MIRT885329	hsa-miR-26b	CLIP-seq
MIRT885330	hsa-miR-3126-5p	CLIP-seq
MIRT885331	hsa-miR-3160-3p	CLIP-seq
MIRT885332	hsa-miR-3175	CLIP-seq
MIRT885333	hsa-miR-3184	CLIP-seq
MIRT885334	hsa-miR-3192	CLIP-seq
MIRT885335	hsa-miR-3200-5p	CLIP-seq
MIRT885336	hsa-miR-326	CLIP-seq
MIRT885337	hsa-miR-330-5p	CLIP-seq
MIRT885338	hsa-miR-3605-5p	CLIP-seq
MIRT885339	hsa-miR-3607-5p	CLIP-seq
MIRT885340	hsa-miR-3677-5p	CLIP-seq
MIRT885341	hsa-miR-3689d	CLIP-seq
MIRT885342	hsa-miR-3911	CLIP-seq
MIRT885343	hsa-miR-423-5p	CLIP-seq
MIRT885344	hsa-miR-4257	CLIP-seq
MIRT885345	hsa-miR-4286	CLIP-seq
MIRT885346	hsa-miR-4314	CLIP-seq
MIRT885347	hsa-miR-4316	CLIP-seq
MIRT885348	hsa-miR-4330	CLIP-seq
MIRT885349	hsa-miR-4419a	CLIP-seq
MIRT885350	hsa-miR-4458	CLIP-seq
MIRT885351	hsa-miR-4465	CLIP-seq
MIRT885352	hsa-miR-4487	CLIP-seq
MIRT885353	hsa-miR-4500	CLIP-seq
MIRT885354	hsa-miR-4510	CLIP-seq
MIRT885355	hsa-miR-4646-5p	CLIP-seq
MIRT885356	hsa-miR-4649-3p	CLIP-seq
MIRT885357	hsa-miR-4716-3p	CLIP-seq
MIRT885358	hsa-miR-4717-3p	CLIP-seq
MIRT885359	hsa-miR-4723-5p	CLIP-seq
MIRT885360	hsa-miR-4731-5p	CLIP-seq
MIRT885361	hsa-miR-4735-5p	CLIP-seq
MIRT885362	hsa-miR-4747-5p	CLIP-seq
MIRT885363	hsa-miR-4751	CLIP-seq
MIRT885364	hsa-miR-519a	CLIP-seq
MIRT885365	hsa-miR-519b-3p	CLIP-seq
MIRT885366	hsa-miR-519c-3p	CLIP-seq
MIRT885367	hsa-miR-556-5p	CLIP-seq
MIRT885368	hsa-miR-558	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT885370	hsa-miR-765	CLIP-seq
MIRT885371	hsa-miR-98	CLIP-seq
MIRT885323	hsa-miR-19a	CLIP-seq
MIRT885324	hsa-miR-19b	CLIP-seq
MIRT885344	hsa-miR-4257	CLIP-seq
MIRT885348	hsa-miR-4330	CLIP-seq
MIRT885361	hsa-miR-4735-5p	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT885315	hsa-miR-1197	CLIP-seq
MIRT885316	hsa-miR-1224-5p	CLIP-seq
MIRT1962599	hsa-miR-1231	CLIP-seq
MIRT1962600	hsa-miR-139-3p	CLIP-seq
MIRT1962601	hsa-miR-296-5p	CLIP-seq
MIRT1962602	hsa-miR-302f	CLIP-seq
MIRT1962603	hsa-miR-329	CLIP-seq
MIRT1962604	hsa-miR-3614-5p	CLIP-seq
MIRT1962605	hsa-miR-362-3p	CLIP-seq
MIRT885341	hsa-miR-3689d	CLIP-seq
MIRT1962606	hsa-miR-3941	CLIP-seq
MIRT1962607	hsa-miR-4443	CLIP-seq
MIRT1962608	hsa-miR-4633-3p	CLIP-seq
MIRT1962609	hsa-miR-4691-5p	CLIP-seq
MIRT1962610	hsa-miR-4718	CLIP-seq
MIRT885363	hsa-miR-4751	CLIP-seq
MIRT1962611	hsa-miR-485-3p	CLIP-seq
MIRT1962612	hsa-miR-532-3p	CLIP-seq
MIRT1962613	hsa-miR-602	CLIP-seq
MIRT1962614	hsa-miR-603	CLIP-seq
MIRT2198902	hsa-miR-1279	CLIP-seq
MIRT885323	hsa-miR-19a	CLIP-seq
MIRT885324	hsa-miR-19b	CLIP-seq
MIRT885344	hsa-miR-4257	CLIP-seq
MIRT885348	hsa-miR-4330	CLIP-seq
MIRT2198903	hsa-miR-4693-3p	CLIP-seq
MIRT2198904	hsa-miR-4712-3p	CLIP-seq
MIRT885361	hsa-miR-4735-5p	CLIP-seq
MIRT2198905	hsa-miR-4778-5p	CLIP-seq
MIRT2198906	hsa-miR-520g	CLIP-seq
MIRT2198907	hsa-miR-520h	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT2198908	hsa-miR-595	CLIP-seq
MIRT2198909	hsa-miR-648	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT2446865	hsa-miR-1236	CLIP-seq
MIRT2446866	hsa-miR-1291	CLIP-seq
MIRT2446867	hsa-miR-1299	CLIP-seq
MIRT2446868	hsa-miR-2117	CLIP-seq
MIRT2446869	hsa-miR-3064-3p	CLIP-seq
MIRT2446870	hsa-miR-3173-5p	CLIP-seq
MIRT2446871	hsa-miR-3202	CLIP-seq
MIRT2446872	hsa-miR-4533	CLIP-seq
MIRT1962609	hsa-miR-4691-5p	CLIP-seq
MIRT2446873	hsa-miR-4768-5p	CLIP-seq
MIRT2446874	hsa-miR-4782-5p	CLIP-seq
MIRT2446875	hsa-miR-516b	CLIP-seq
MIRT2446876	hsa-miR-875-3p	CLIP-seq
MIRT2501675	hsa-miR-1204	CLIP-seq
MIRT885316	hsa-miR-1224-5p	CLIP-seq
MIRT1962599	hsa-miR-1231	CLIP-seq
MIRT2446865	hsa-miR-1236	CLIP-seq
MIRT2501676	hsa-miR-1258	CLIP-seq
MIRT2501677	hsa-miR-1273g	CLIP-seq
MIRT2446866	hsa-miR-1291	CLIP-seq
MIRT2501678	hsa-miR-1293	CLIP-seq
MIRT2446867	hsa-miR-1299	CLIP-seq
MIRT2501679	hsa-miR-1306	CLIP-seq
MIRT1962600	hsa-miR-139-3p	CLIP-seq
MIRT2501680	hsa-miR-1825	CLIP-seq
MIRT2501681	hsa-miR-199a-5p	CLIP-seq
MIRT2501682	hsa-miR-199b-5p	CLIP-seq
MIRT2446868	hsa-miR-2117	CLIP-seq
MIRT1962601	hsa-miR-296-5p	CLIP-seq
MIRT2446869	hsa-miR-3064-3p	CLIP-seq
MIRT2501683	hsa-miR-3064-5p	CLIP-seq
MIRT2501684	hsa-miR-3117-5p	CLIP-seq
MIRT2501685	hsa-miR-3127-5p	CLIP-seq
MIRT2501686	hsa-miR-3150b-3p	CLIP-seq
MIRT2501687	hsa-miR-3152-5p	CLIP-seq
MIRT2501688	hsa-miR-3170	CLIP-seq
MIRT2446870	hsa-miR-3173-5p	CLIP-seq
MIRT2446871	hsa-miR-3202	CLIP-seq
MIRT2501689	hsa-miR-339-5p	CLIP-seq
MIRT2501690	hsa-miR-342-5p	CLIP-seq
MIRT2501691	hsa-miR-3672	CLIP-seq
MIRT2501692	hsa-miR-3915	CLIP-seq
MIRT2501693	hsa-miR-3925-3p	CLIP-seq
MIRT2501694	hsa-miR-3929	CLIP-seq
MIRT2501695	hsa-miR-4263	CLIP-seq
MIRT2501696	hsa-miR-4287	CLIP-seq
MIRT2501697	hsa-miR-4312	CLIP-seq
MIRT2501698	hsa-miR-4326	CLIP-seq
MIRT2501699	hsa-miR-4419b	CLIP-seq
MIRT2501700	hsa-miR-4425	CLIP-seq
MIRT2501701	hsa-miR-4455	CLIP-seq
MIRT2501702	hsa-miR-4469	CLIP-seq
MIRT2501703	hsa-miR-4478	CLIP-seq
MIRT2501704	hsa-miR-4483	CLIP-seq
MIRT2446872	hsa-miR-4533	CLIP-seq
MIRT2501705	hsa-miR-4651	CLIP-seq
MIRT2501706	hsa-miR-4655-3p	CLIP-seq
MIRT2501707	hsa-miR-4664-5p	CLIP-seq
MIRT2501708	hsa-miR-4667-5p	CLIP-seq
MIRT2501709	hsa-miR-4685-3p	CLIP-seq
MIRT2501710	hsa-miR-4689	CLIP-seq
MIRT1962609	hsa-miR-4691-5p	CLIP-seq
MIRT2501711	hsa-miR-4700-5p	CLIP-seq
MIRT2501712	hsa-miR-4757-5p	CLIP-seq
MIRT2446873	hsa-miR-4768-5p	CLIP-seq
MIRT2501713	hsa-miR-4774-3p	CLIP-seq
MIRT2446874	hsa-miR-4782-5p	CLIP-seq
MIRT2501714	hsa-miR-4784	CLIP-seq
MIRT2501715	hsa-miR-508-5p	CLIP-seq
MIRT2446875	hsa-miR-516b	CLIP-seq
MIRT2198906	hsa-miR-520g	CLIP-seq
MIRT2198907	hsa-miR-520h	CLIP-seq
MIRT2501716	hsa-miR-563	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT2198908	hsa-miR-595	CLIP-seq
MIRT2501717	hsa-miR-604	CLIP-seq
MIRT2501718	hsa-miR-608	CLIP-seq
MIRT2501719	hsa-miR-615-5p	CLIP-seq
MIRT2501720	hsa-miR-637	CLIP-seq
MIRT2501721	hsa-miR-647	CLIP-seq
MIRT2198909	hsa-miR-648	CLIP-seq
MIRT2446876	hsa-miR-875-3p	CLIP-seq
MIRT2501722	hsa-miR-876-3p	CLIP-seq
MIRT2501675	hsa-miR-1204	CLIP-seq
MIRT885316	hsa-miR-1224-5p	CLIP-seq
MIRT1962599	hsa-miR-1231	CLIP-seq
MIRT2446865	hsa-miR-1236	CLIP-seq
MIRT2501676	hsa-miR-1258	CLIP-seq
MIRT2501677	hsa-miR-1273g	CLIP-seq
MIRT2446866	hsa-miR-1291	CLIP-seq
MIRT2501678	hsa-miR-1293	CLIP-seq
MIRT2446867	hsa-miR-1299	CLIP-seq
MIRT2501679	hsa-miR-1306	CLIP-seq
MIRT1962600	hsa-miR-139-3p	CLIP-seq
MIRT2501680	hsa-miR-1825	CLIP-seq
MIRT2501681	hsa-miR-199a-5p	CLIP-seq
MIRT2501682	hsa-miR-199b-5p	CLIP-seq
MIRT2446868	hsa-miR-2117	CLIP-seq
MIRT1962601	hsa-miR-296-5p	CLIP-seq
MIRT2446869	hsa-miR-3064-3p	CLIP-seq
MIRT2501683	hsa-miR-3064-5p	CLIP-seq
MIRT2501684	hsa-miR-3117-5p	CLIP-seq
MIRT2501685	hsa-miR-3127-5p	CLIP-seq
MIRT2501686	hsa-miR-3150b-3p	CLIP-seq
MIRT2501687	hsa-miR-3152-5p	CLIP-seq
MIRT2501688	hsa-miR-3170	CLIP-seq
MIRT2446870	hsa-miR-3173-5p	CLIP-seq
MIRT2446871	hsa-miR-3202	CLIP-seq
MIRT2501689	hsa-miR-339-5p	CLIP-seq
MIRT2501690	hsa-miR-342-5p	CLIP-seq
MIRT2501691	hsa-miR-3672	CLIP-seq
MIRT2501692	hsa-miR-3915	CLIP-seq
MIRT2501693	hsa-miR-3925-3p	CLIP-seq
MIRT2501694	hsa-miR-3929	CLIP-seq
MIRT2501695	hsa-miR-4263	CLIP-seq
MIRT2678018	hsa-miR-4282	CLIP-seq
MIRT2501696	hsa-miR-4287	CLIP-seq
MIRT2501697	hsa-miR-4312	CLIP-seq
MIRT2501698	hsa-miR-4326	CLIP-seq
MIRT2501699	hsa-miR-4419b	CLIP-seq
MIRT2501700	hsa-miR-4425	CLIP-seq
MIRT2501701	hsa-miR-4455	CLIP-seq
MIRT2501702	hsa-miR-4469	CLIP-seq
MIRT2501703	hsa-miR-4478	CLIP-seq
MIRT2501704	hsa-miR-4483	CLIP-seq
MIRT2446872	hsa-miR-4533	CLIP-seq
MIRT2501705	hsa-miR-4651	CLIP-seq
MIRT2501706	hsa-miR-4655-3p	CLIP-seq
MIRT2501707	hsa-miR-4664-5p	CLIP-seq
MIRT2501708	hsa-miR-4667-5p	CLIP-seq
MIRT2501709	hsa-miR-4685-3p	CLIP-seq
MIRT2501710	hsa-miR-4689	CLIP-seq
MIRT1962609	hsa-miR-4691-5p	CLIP-seq
MIRT2501711	hsa-miR-4700-5p	CLIP-seq
MIRT2501712	hsa-miR-4757-5p	CLIP-seq
MIRT2446873	hsa-miR-4768-5p	CLIP-seq
MIRT2501713	hsa-miR-4774-3p	CLIP-seq
MIRT2446874	hsa-miR-4782-5p	CLIP-seq
MIRT2501714	hsa-miR-4784	CLIP-seq
MIRT2501715	hsa-miR-508-5p	CLIP-seq
MIRT2446875	hsa-miR-516b	CLIP-seq
MIRT2198906	hsa-miR-520g	CLIP-seq
MIRT2198907	hsa-miR-520h	CLIP-seq
MIRT2501716	hsa-miR-563	CLIP-seq
MIRT885369	hsa-miR-576-5p	CLIP-seq
MIRT2198908	hsa-miR-595	CLIP-seq
MIRT2501717	hsa-miR-604	CLIP-seq
MIRT2501718	hsa-miR-608	CLIP-seq
MIRT2501719	hsa-miR-615-5p	CLIP-seq
MIRT2501720	hsa-miR-637	CLIP-seq
MIRT2501721	hsa-miR-647	CLIP-seq
MIRT2198909	hsa-miR-648	CLIP-seq
MIRT2446876	hsa-miR-875-3p	CLIP-seq
MIRT2501722	hsa-miR-876-3p	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000939	Component	Inner kinetochore	IPI	36085283
GO:0005515	Function	Protein binding	IPI	25416956, 26496610, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	36085283
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007059	Process	Chromosome segregation	NAS	36085283
GO:0034080	Process	CENP-A containing chromatin assembly	IEA

MIM	HGNC	e!Ensembl
611505	32933	ENSG00000188312

Q6IPU0

Protein name

Centromere protein P (CENP-P)

Protein function

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesiz

PDB

7PB8 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13096	CENP-P	103 → 279	CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P	Family

Sequence

MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQL
GHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEF
QILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYR
KRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLT
KVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN

Sequence length

288

Interactions

View interactions

Reactome Pathway
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Low-frequency hearing loss	Likely pathogenic	rs767442671	RCV002246208	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Low-frequency sensorineural hearing impairment	Likely pathogenic	rs767442671	RCV002246208	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
ALZHEIMER DISEASE	—	GWAS catalog	37985413	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENPP-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	29885931	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	36989840	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	29924316	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Deafness Autosomal Dominant 1	Deafness	Pubtator	36071244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	36071244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	23418382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23418382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	23418382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ECM2	1	["Obstructive sleep apnea syndrome"]	0	[]	2	["GWAS catalog (Kidney disease)","GWAS catalog (Obstructive sleep apnea syndrome)"]
CENPA	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPC	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPI	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
CENPQ	0	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]

CENPP (centromere protein P)

Bookmark This Gene