Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64946
Gene name	Centromere protein H
Gene symbol	CENPH
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q13.2
Summary	Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interpha

101 Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714732	hsa-miR-4668-3p	HITS-CLIP	19536157
MIRT714731	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT714730	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT714729	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT714728	hsa-miR-8063	HITS-CLIP	19536157
MIRT714727	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT714726	hsa-miR-4470	HITS-CLIP	19536157
MIRT714725	hsa-miR-3688-5p	HITS-CLIP	19536157
MIRT714732	hsa-miR-4668-3p	HITS-CLIP	19536157
MIRT714731	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT714730	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT714729	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT714728	hsa-miR-8063	HITS-CLIP	19536157
MIRT714727	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT714726	hsa-miR-4470	HITS-CLIP	19536157
MIRT714725	hsa-miR-3688-5p	HITS-CLIP	19536157
MIRT884911	hsa-miR-105	CLIP-seq
MIRT884912	hsa-miR-1246	CLIP-seq
MIRT884913	hsa-miR-1273e	CLIP-seq
MIRT884914	hsa-miR-1285	CLIP-seq
MIRT884915	hsa-miR-1827	CLIP-seq
MIRT884916	hsa-miR-219-1-3p	CLIP-seq
MIRT884917	hsa-miR-3065-5p	CLIP-seq
MIRT884918	hsa-miR-3138	CLIP-seq
MIRT884919	hsa-miR-3140-3p	CLIP-seq
MIRT884920	hsa-miR-3187-5p	CLIP-seq
MIRT884921	hsa-miR-3201	CLIP-seq
MIRT884922	hsa-miR-3689a-3p	CLIP-seq
MIRT884923	hsa-miR-3689c	CLIP-seq
MIRT884924	hsa-miR-371-5p	CLIP-seq
MIRT884925	hsa-miR-371b-5p	CLIP-seq
MIRT884926	hsa-miR-378g	CLIP-seq
MIRT884927	hsa-miR-3925-3p	CLIP-seq
MIRT884928	hsa-miR-3929	CLIP-seq
MIRT884929	hsa-miR-4252	CLIP-seq
MIRT884930	hsa-miR-4263	CLIP-seq
MIRT884931	hsa-miR-4282	CLIP-seq
MIRT884932	hsa-miR-4290	CLIP-seq
MIRT884933	hsa-miR-4419b	CLIP-seq
MIRT884934	hsa-miR-4478	CLIP-seq
MIRT884935	hsa-miR-4486	CLIP-seq
MIRT884936	hsa-miR-4520a-3p	CLIP-seq
MIRT884937	hsa-miR-4537	CLIP-seq
MIRT884938	hsa-miR-4649-3p	CLIP-seq
MIRT884939	hsa-miR-4684-5p	CLIP-seq
MIRT884940	hsa-miR-4728-5p	CLIP-seq
MIRT884941	hsa-miR-4791	CLIP-seq
MIRT884942	hsa-miR-4799-5p	CLIP-seq
MIRT884943	hsa-miR-485-5p	CLIP-seq
MIRT884944	hsa-miR-576-5p	CLIP-seq
MIRT884945	hsa-miR-612	CLIP-seq
MIRT884946	hsa-miR-622	CLIP-seq
MIRT884947	hsa-miR-890	CLIP-seq
MIRT884927	hsa-miR-3925-3p	CLIP-seq
MIRT884932	hsa-miR-4290	CLIP-seq
MIRT884946	hsa-miR-622	CLIP-seq
MIRT884913	hsa-miR-1273e	CLIP-seq
MIRT884915	hsa-miR-1827	CLIP-seq
MIRT2198840	hsa-miR-2467-3p	CLIP-seq
MIRT2198841	hsa-miR-3607-3p	CLIP-seq
MIRT2198842	hsa-miR-3612	CLIP-seq
MIRT2198843	hsa-miR-3686	CLIP-seq
MIRT2198844	hsa-miR-4257	CLIP-seq
MIRT2198845	hsa-miR-4433	CLIP-seq
MIRT2198846	hsa-miR-500a	CLIP-seq
MIRT2198847	hsa-miR-650	CLIP-seq
MIRT884913	hsa-miR-1273e	CLIP-seq
MIRT884915	hsa-miR-1827	CLIP-seq
MIRT2198840	hsa-miR-2467-3p	CLIP-seq
MIRT2198841	hsa-miR-3607-3p	CLIP-seq
MIRT2198842	hsa-miR-3612	CLIP-seq
MIRT2198843	hsa-miR-3686	CLIP-seq
MIRT2198844	hsa-miR-4257	CLIP-seq
MIRT884937	hsa-miR-4537	CLIP-seq
MIRT2385936	hsa-miR-4798-5p	CLIP-seq
MIRT2198846	hsa-miR-500a	CLIP-seq
MIRT2198847	hsa-miR-650	CLIP-seq
MIRT884914	hsa-miR-1285	CLIP-seq
MIRT884920	hsa-miR-3187-5p	CLIP-seq
MIRT2446848	hsa-miR-3945	CLIP-seq
MIRT2446849	hsa-miR-4253	CLIP-seq
MIRT884939	hsa-miR-4684-5p	CLIP-seq
MIRT884945	hsa-miR-612	CLIP-seq
MIRT884914	hsa-miR-1285	CLIP-seq
MIRT884920	hsa-miR-3187-5p	CLIP-seq
MIRT884939	hsa-miR-4684-5p	CLIP-seq
MIRT884945	hsa-miR-612	CLIP-seq
MIRT884914	hsa-miR-1285	CLIP-seq
MIRT884920	hsa-miR-3187-5p	CLIP-seq
MIRT2501644	hsa-miR-3622b-5p	CLIP-seq
MIRT2446848	hsa-miR-3945	CLIP-seq
MIRT2446849	hsa-miR-4253	CLIP-seq
MIRT884939	hsa-miR-4684-5p	CLIP-seq
MIRT884945	hsa-miR-612	CLIP-seq
MIRT884914	hsa-miR-1285	CLIP-seq
MIRT884920	hsa-miR-3187-5p	CLIP-seq
MIRT2501644	hsa-miR-3622b-5p	CLIP-seq
MIRT2446848	hsa-miR-3945	CLIP-seq
MIRT2446849	hsa-miR-4253	CLIP-seq
MIRT884939	hsa-miR-4684-5p	CLIP-seq
MIRT884945	hsa-miR-612	CLIP-seq

Transcription factor	Regulation	Reference
SP1	Activation	22682030
SP3	Activation	22682030

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	11092768
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	IMP	20212317
GO:0000776	Component	Kinetochore	NAS	11092768
GO:0000939	Component	Inner kinetochore	IPI	36085283
GO:0005515	Function	Protein binding	IPI	11092768, 15713649, 24981860, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11092768
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	36085283
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	NAS	36085283
GO:0043515	Function	Kinetochore binding	IBA
GO:0043515	Function	Kinetochore binding	IDA	11092768
GO:0043515	Function	Kinetochore binding	IEA
GO:0051382	Process	Kinetochore assembly	IEA
GO:0051383	Process	Kinetochore organization	TAS	11092768

MIM	HGNC	e!Ensembl
605607	17268	ENSG00000153044

Q9H3R5

Protein name

Centromere protein H (CENP-H) (Interphase centromere complex protein 35)

Protein function

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal)

PDB

7PB4 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05837	CENP-H	126 → 239	Centromere protein H (CENP-H)	Domain

Sequence

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSM
VDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKIS
RQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKN
KQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL
EKNVDMM

Sequence length

247

Interactions

View interactions

Reactome Pathway
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Recurrent spontaneous abortion	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (26)
Breast Carcinoma	Breast Carcinoma	BEFREE	21880184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21880184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19500341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15930286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15930286, 28819418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15930286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30658502, 37328854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26248586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18700042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	17016595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23970101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19170237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21880184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21388066, 22999412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	19500341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21388066, 22631655, 23970101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22682030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22682030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28819418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26248586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17016595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22631655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	22631655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21388066, 22999412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	19500341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
CENPA	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	[]
CENPC	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	[]
CENPI	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	[]
CENPP	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	[]
CENPQ	[]	7	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Deposition of new CENPA-containing nucleosomes at the centromere","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	[]

CENPH (centromere protein H)

Bookmark This Gene