Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	993
Gene name	Cell division cycle 25A
Gene symbol	CDC25A
Synonyms (NCBI Gene)	CDC25A2
Chromosome	3
Chromosome location	3p21.31
Summary	CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in respons

446 Show/Hide all (446)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001011	hsa-miR-34a-5p	Western blot	18406353
MIRT000655	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT000648	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT000284	hsa-miR-15a-5p	Luciferase reporter assay	18949056
MIRT003186	hsa-miR-449a	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19833767
MIRT002296	hsa-let-7b-5p	ImmunohistochemistryqRT-PCR	19966857
MIRT002296	hsa-let-7b-5p	Luciferase reporter assayMicroarrayWestern blot	17699775
MIRT000157	hsa-miR-21-5p	MicroarrayNorthern blotqRT-PCR	19826040
MIRT000157	hsa-miR-21-5p	MicroarrayNorthern blotqRT-PCR	19826040
MIRT000157	hsa-miR-21-5p	Luciferase reporter assay	23496142
MIRT016138	hsa-miR-449b-5p	Reporter assay;Western blot	19833767
MIRT016313	hsa-miR-193b-3p	Microarray	20304954
MIRT003186	hsa-miR-449a	Reporter assay;Western blot;Other	19833767
MIRT026127	hsa-miR-192-5p	Microarray	19074876
MIRT027018	hsa-miR-103a-3p	Sequencing	20371350
MIRT027421	hsa-miR-98-5p	Microarray	19088304
MIRT000157	hsa-miR-21-5p	Microarray	18591254
MIRT031451	hsa-miR-16-5p	Sequencing	20371350
MIRT049120	hsa-miR-92a-3p	CLASH	23622248
MIRT046546	hsa-let-7i-5p	CLASH	23622248
MIRT041718	hsa-miR-484	CLASH	23622248
MIRT040942	hsa-miR-18a-3p	CLASH	23622248
MIRT036976	hsa-miR-877-3p	CLASH	23622248
MIRT053583	hsa-miR-365a-3p	FlowIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24149576
MIRT054799	hsa-miR-141-3p	Luciferase reporter assayImmunoblotWestern blot	24937190
MIRT437792	hsa-miR-195-5p	Luciferase reporter assayWestern blot	23544130
MIRT437797	hsa-miR-497-5p	Luciferase reporter assayWestern blot	23544130
MIRT003186	hsa-miR-449a	Luciferase reporter assay	23590309
MIRT479631	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT000284	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT031451	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT437797	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT437792	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT000655	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479630	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT000648	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT479629	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT479628	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT479627	hsa-miR-4323	PAR-CLIP	23592263
MIRT479626	hsa-miR-624-5p	PAR-CLIP	23592263
MIRT479625	hsa-miR-5584-3p	PAR-CLIP	23592263
MIRT162603	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT479624	hsa-miR-4712-5p	PAR-CLIP	23592263
MIRT479623	hsa-miR-770-5p	PAR-CLIP	23592263
MIRT479622	hsa-miR-1281	PAR-CLIP	23592263
MIRT479620	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT479621	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT479619	hsa-miR-668-5p	PAR-CLIP	23592263
MIRT479618	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT479617	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT479616	hsa-miR-4803	PAR-CLIP	23592263
MIRT479615	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479614	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT479613	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT479612	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT479611	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT479610	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT479608	hsa-miR-5693	PAR-CLIP	23592263
MIRT479609	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT479607	hsa-miR-3138	PAR-CLIP	23592263
MIRT000157	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000284	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT479631	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031451	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT437792	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT000157	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000157	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25378484
MIRT000157	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25378484
MIRT000408	hsa-let-7c-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25909324
MIRT736685	hsa-miR-483-3p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCR	23429262
MIRT479631	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT000284	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT031451	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT437797	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT437792	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT000655	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479630	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT000648	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT479629	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT479628	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT479627	hsa-miR-4323	PAR-CLIP	23592263
MIRT479626	hsa-miR-624-5p	PAR-CLIP	23592263
MIRT479625	hsa-miR-5584-3p	PAR-CLIP	23592263
MIRT162603	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT479624	hsa-miR-4712-5p	PAR-CLIP	23592263
MIRT479623	hsa-miR-770-5p	PAR-CLIP	23592263
MIRT479622	hsa-miR-1281	PAR-CLIP	23592263
MIRT479620	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT479621	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT479619	hsa-miR-668-5p	PAR-CLIP	23592263
MIRT479618	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT479617	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT479616	hsa-miR-4803	PAR-CLIP	23592263
MIRT479615	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479614	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT479613	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT479612	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT479611	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT479610	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT479608	hsa-miR-5693	PAR-CLIP	23592263
MIRT479609	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT479607	hsa-miR-3138	PAR-CLIP	23592263
MIRT054799	hsa-miR-141-3p	MicroarrayqRT-PCR	35816043
MIRT000284	hsa-miR-15a-5p	MicroarrayqRT-PCR	35816043
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876921	hsa-miR-1226	CLIP-seq
MIRT876922	hsa-miR-1229	CLIP-seq
MIRT876923	hsa-miR-1250	CLIP-seq
MIRT876924	hsa-miR-1262	CLIP-seq
MIRT876925	hsa-miR-1293	CLIP-seq
MIRT876926	hsa-miR-141	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT876930	hsa-miR-1915	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876932	hsa-miR-200a	CLIP-seq
MIRT876933	hsa-miR-21	CLIP-seq
MIRT876934	hsa-miR-2115	CLIP-seq
MIRT876935	hsa-miR-217	CLIP-seq
MIRT876936	hsa-miR-3124-3p	CLIP-seq
MIRT876937	hsa-miR-3158-3p	CLIP-seq
MIRT876938	hsa-miR-3183	CLIP-seq
MIRT876939	hsa-miR-3185	CLIP-seq
MIRT876940	hsa-miR-3187-3p	CLIP-seq
MIRT876941	hsa-miR-3189-3p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT876943	hsa-miR-323-5p	CLIP-seq
MIRT876944	hsa-miR-323b-5p	CLIP-seq
MIRT876945	hsa-miR-33a	CLIP-seq
MIRT876946	hsa-miR-33b	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT876948	hsa-miR-3620	CLIP-seq
MIRT876949	hsa-miR-3667-3p	CLIP-seq
MIRT876950	hsa-miR-3907	CLIP-seq
MIRT876951	hsa-miR-3909	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876953	hsa-miR-4269	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT876955	hsa-miR-4279	CLIP-seq
MIRT876956	hsa-miR-4289	CLIP-seq
MIRT876957	hsa-miR-4310	CLIP-seq
MIRT876958	hsa-miR-4435	CLIP-seq
MIRT876959	hsa-miR-4462	CLIP-seq
MIRT876960	hsa-miR-4474-3p	CLIP-seq
MIRT876961	hsa-miR-4476	CLIP-seq
MIRT876962	hsa-miR-4483	CLIP-seq
MIRT876963	hsa-miR-4514	CLIP-seq
MIRT876964	hsa-miR-4524	CLIP-seq
MIRT876965	hsa-miR-4530	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT876967	hsa-miR-4685-5p	CLIP-seq
MIRT876968	hsa-miR-4692	CLIP-seq
MIRT876969	hsa-miR-4701-3p	CLIP-seq
MIRT876970	hsa-miR-4701-5p	CLIP-seq
MIRT876971	hsa-miR-4723-3p	CLIP-seq
MIRT876972	hsa-miR-4726-3p	CLIP-seq
MIRT876973	hsa-miR-4733-3p	CLIP-seq
MIRT876974	hsa-miR-4742-5p	CLIP-seq
MIRT876975	hsa-miR-4749-3p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT876977	hsa-miR-503	CLIP-seq
MIRT876978	hsa-miR-511	CLIP-seq
MIRT876979	hsa-miR-548s	CLIP-seq
MIRT876980	hsa-miR-588	CLIP-seq
MIRT876981	hsa-miR-590-5p	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT876983	hsa-miR-661	CLIP-seq
MIRT876984	hsa-let-7a	CLIP-seq
MIRT876985	hsa-let-7b	CLIP-seq
MIRT876986	hsa-let-7c	CLIP-seq
MIRT876987	hsa-let-7d	CLIP-seq
MIRT876988	hsa-let-7e	CLIP-seq
MIRT876989	hsa-let-7f	CLIP-seq
MIRT876990	hsa-let-7g	CLIP-seq
MIRT876991	hsa-let-7i	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876992	hsa-miR-106a	CLIP-seq
MIRT876993	hsa-miR-106b	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT876996	hsa-miR-122	CLIP-seq
MIRT876921	hsa-miR-1226	CLIP-seq
MIRT876922	hsa-miR-1229	CLIP-seq
MIRT876997	hsa-miR-1246	CLIP-seq
MIRT876998	hsa-miR-1260	CLIP-seq
MIRT876999	hsa-miR-1260b	CLIP-seq
MIRT877000	hsa-miR-1264	CLIP-seq
MIRT877001	hsa-miR-1305	CLIP-seq
MIRT876926	hsa-miR-141	CLIP-seq
MIRT877002	hsa-miR-142-5p	CLIP-seq
MIRT877003	hsa-miR-146b-3p	CLIP-seq
MIRT877004	hsa-miR-155	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT877005	hsa-miR-17	CLIP-seq
MIRT877006	hsa-miR-188-3p	CLIP-seq
MIRT877007	hsa-miR-193a-5p	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876932	hsa-miR-200a	CLIP-seq
MIRT877008	hsa-miR-203	CLIP-seq
MIRT877009	hsa-miR-20a	CLIP-seq
MIRT877010	hsa-miR-20b	CLIP-seq
MIRT876934	hsa-miR-2115	CLIP-seq
MIRT877011	hsa-miR-3146	CLIP-seq
MIRT877012	hsa-miR-3156-3p	CLIP-seq
MIRT877013	hsa-miR-3156-5p	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877015	hsa-miR-3163	CLIP-seq
MIRT877016	hsa-miR-3173-3p	CLIP-seq
MIRT877017	hsa-miR-3173-5p	CLIP-seq
MIRT876941	hsa-miR-3189-3p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT877018	hsa-miR-320e	CLIP-seq
MIRT876943	hsa-miR-323-5p	CLIP-seq
MIRT877019	hsa-miR-34a	CLIP-seq
MIRT877020	hsa-miR-34c-5p	CLIP-seq
MIRT877021	hsa-miR-3609	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT877022	hsa-miR-3689a-3p	CLIP-seq
MIRT877023	hsa-miR-3689c	CLIP-seq
MIRT877024	hsa-miR-378g	CLIP-seq
MIRT877025	hsa-miR-3925-3p	CLIP-seq
MIRT877026	hsa-miR-3942-3p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT877027	hsa-miR-4268	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT877028	hsa-miR-4292	CLIP-seq
MIRT877029	hsa-miR-4301	CLIP-seq
MIRT877030	hsa-miR-4314	CLIP-seq
MIRT877031	hsa-miR-4428	CLIP-seq
MIRT877032	hsa-miR-4433	CLIP-seq
MIRT877033	hsa-miR-4437	CLIP-seq
MIRT877034	hsa-miR-4448	CLIP-seq
MIRT877035	hsa-miR-4458	CLIP-seq
MIRT877036	hsa-miR-4464	CLIP-seq
MIRT877037	hsa-miR-449b	CLIP-seq
MIRT877038	hsa-miR-4500	CLIP-seq
MIRT877039	hsa-miR-451b	CLIP-seq
MIRT876964	hsa-miR-4524	CLIP-seq
MIRT877040	hsa-miR-4525	CLIP-seq
MIRT877041	hsa-miR-4646-5p	CLIP-seq
MIRT877042	hsa-miR-4648	CLIP-seq
MIRT877043	hsa-miR-4653-3p	CLIP-seq
MIRT877044	hsa-miR-4654	CLIP-seq
MIRT877045	hsa-miR-4670-3p	CLIP-seq
MIRT877046	hsa-miR-4674	CLIP-seq
MIRT877047	hsa-miR-4676-5p	CLIP-seq
MIRT877048	hsa-miR-4695-5p	CLIP-seq
MIRT877049	hsa-miR-4709-5p	CLIP-seq
MIRT877050	hsa-miR-4714-3p	CLIP-seq
MIRT877051	hsa-miR-4716-3p	CLIP-seq
MIRT877052	hsa-miR-4720-3p	CLIP-seq
MIRT877053	hsa-miR-4728-5p	CLIP-seq
MIRT876973	hsa-miR-4733-3p	CLIP-seq
MIRT877054	hsa-miR-4733-5p	CLIP-seq
MIRT877055	hsa-miR-4748	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877057	hsa-miR-4769-5p	CLIP-seq
MIRT877058	hsa-miR-4774-5p	CLIP-seq
MIRT877059	hsa-miR-4793-5p	CLIP-seq
MIRT877060	hsa-miR-4796-3p	CLIP-seq
MIRT877061	hsa-miR-4802-5p	CLIP-seq
MIRT877062	hsa-miR-4804-3p	CLIP-seq
MIRT877063	hsa-miR-485-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT876977	hsa-miR-503	CLIP-seq
MIRT877064	hsa-miR-510	CLIP-seq
MIRT877065	hsa-miR-519d	CLIP-seq
MIRT877066	hsa-miR-541	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877068	hsa-miR-548ah	CLIP-seq
MIRT877069	hsa-miR-574-5p	CLIP-seq
MIRT877070	hsa-miR-575	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT877072	hsa-miR-621	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT877073	hsa-miR-654-5p	CLIP-seq
MIRT877074	hsa-miR-665	CLIP-seq
MIRT877075	hsa-miR-766	CLIP-seq
MIRT877076	hsa-miR-874	CLIP-seq
MIRT877077	hsa-miR-93	CLIP-seq
MIRT877078	hsa-miR-98	CLIP-seq
MIRT876984	hsa-let-7a	CLIP-seq
MIRT876985	hsa-let-7b	CLIP-seq
MIRT876986	hsa-let-7c	CLIP-seq
MIRT876987	hsa-let-7d	CLIP-seq
MIRT876988	hsa-let-7e	CLIP-seq
MIRT876989	hsa-let-7f	CLIP-seq
MIRT876990	hsa-let-7g	CLIP-seq
MIRT876991	hsa-let-7i	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876992	hsa-miR-106a	CLIP-seq
MIRT876993	hsa-miR-106b	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT1959912	hsa-miR-1207-5p	CLIP-seq
MIRT1959913	hsa-miR-1224-3p	CLIP-seq
MIRT877000	hsa-miR-1264	CLIP-seq
MIRT877002	hsa-miR-142-5p	CLIP-seq
MIRT877004	hsa-miR-155	CLIP-seq
MIRT1959914	hsa-miR-1587	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT877005	hsa-miR-17	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT877009	hsa-miR-20a	CLIP-seq
MIRT877010	hsa-miR-20b	CLIP-seq
MIRT1959915	hsa-miR-2682	CLIP-seq
MIRT1959916	hsa-miR-3127-3p	CLIP-seq
MIRT877011	hsa-miR-3146	CLIP-seq
MIRT877015	hsa-miR-3163	CLIP-seq
MIRT877021	hsa-miR-3609	CLIP-seq
MIRT876947	hsa-miR-361-3p	CLIP-seq
MIRT1959917	hsa-miR-3616-3p	CLIP-seq
MIRT1959918	hsa-miR-3652	CLIP-seq
MIRT877025	hsa-miR-3925-3p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876957	hsa-miR-4310	CLIP-seq
MIRT1959919	hsa-miR-4423-3p	CLIP-seq
MIRT1959920	hsa-miR-4430	CLIP-seq
MIRT877032	hsa-miR-4433	CLIP-seq
MIRT1959921	hsa-miR-4436b-3p	CLIP-seq
MIRT1959922	hsa-miR-4453	CLIP-seq
MIRT877035	hsa-miR-4458	CLIP-seq
MIRT1959923	hsa-miR-4492	CLIP-seq
MIRT1959924	hsa-miR-4498	CLIP-seq
MIRT1959925	hsa-miR-449c	CLIP-seq
MIRT877038	hsa-miR-4500	CLIP-seq
MIRT1959926	hsa-miR-4505	CLIP-seq
MIRT877040	hsa-miR-4525	CLIP-seq
MIRT876965	hsa-miR-4530	CLIP-seq
MIRT1959927	hsa-miR-4534	CLIP-seq
MIRT1959928	hsa-miR-4538	CLIP-seq
MIRT1959929	hsa-miR-4640-3p	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT877043	hsa-miR-4653-3p	CLIP-seq
MIRT1959930	hsa-miR-4656	CLIP-seq
MIRT877046	hsa-miR-4674	CLIP-seq
MIRT1959931	hsa-miR-4675	CLIP-seq
MIRT877051	hsa-miR-4716-3p	CLIP-seq
MIRT1959932	hsa-miR-4741	CLIP-seq
MIRT1959933	hsa-miR-4753-3p	CLIP-seq
MIRT1959934	hsa-miR-4753-5p	CLIP-seq
MIRT1959935	hsa-miR-4763-3p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877060	hsa-miR-4796-3p	CLIP-seq
MIRT877061	hsa-miR-4802-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT877065	hsa-miR-519d	CLIP-seq
MIRT877068	hsa-miR-548ah	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT1959936	hsa-miR-635	CLIP-seq
MIRT877074	hsa-miR-665	CLIP-seq
MIRT1959937	hsa-miR-762	CLIP-seq
MIRT877075	hsa-miR-766	CLIP-seq
MIRT877077	hsa-miR-93	CLIP-seq
MIRT1959938	hsa-miR-940	CLIP-seq
MIRT877078	hsa-miR-98	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT1959913	hsa-miR-1224-3p	CLIP-seq
MIRT876998	hsa-miR-1260	CLIP-seq
MIRT876999	hsa-miR-1260b	CLIP-seq
MIRT2196895	hsa-miR-1280	CLIP-seq
MIRT876927	hsa-miR-15a	CLIP-seq
MIRT876928	hsa-miR-15b	CLIP-seq
MIRT876929	hsa-miR-16	CLIP-seq
MIRT2196896	hsa-miR-184	CLIP-seq
MIRT2196897	hsa-miR-190	CLIP-seq
MIRT2196898	hsa-miR-190b	CLIP-seq
MIRT876930	hsa-miR-1915	CLIP-seq
MIRT877007	hsa-miR-193a-5p	CLIP-seq
MIRT876931	hsa-miR-195	CLIP-seq
MIRT876933	hsa-miR-21	CLIP-seq
MIRT876935	hsa-miR-217	CLIP-seq
MIRT2196899	hsa-miR-2278	CLIP-seq
MIRT2196900	hsa-miR-24	CLIP-seq
MIRT877012	hsa-miR-3156-3p	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT2196901	hsa-miR-3160-5p	CLIP-seq
MIRT876942	hsa-miR-3192	CLIP-seq
MIRT876945	hsa-miR-33a	CLIP-seq
MIRT876946	hsa-miR-33b	CLIP-seq
MIRT2196902	hsa-miR-3663-3p	CLIP-seq
MIRT2196903	hsa-miR-3688-5p	CLIP-seq
MIRT876952	hsa-miR-424	CLIP-seq
MIRT876953	hsa-miR-4269	CLIP-seq
MIRT876954	hsa-miR-4277	CLIP-seq
MIRT876955	hsa-miR-4279	CLIP-seq
MIRT2196904	hsa-miR-4284	CLIP-seq
MIRT876956	hsa-miR-4289	CLIP-seq
MIRT877029	hsa-miR-4301	CLIP-seq
MIRT877030	hsa-miR-4314	CLIP-seq
MIRT2196905	hsa-miR-4318	CLIP-seq
MIRT876959	hsa-miR-4462	CLIP-seq
MIRT876960	hsa-miR-4474-3p	CLIP-seq
MIRT876963	hsa-miR-4514	CLIP-seq
MIRT2196906	hsa-miR-4517	CLIP-seq
MIRT877041	hsa-miR-4646-5p	CLIP-seq
MIRT2196907	hsa-miR-4651	CLIP-seq
MIRT876966	hsa-miR-4652-3p	CLIP-seq
MIRT877047	hsa-miR-4676-5p	CLIP-seq
MIRT876968	hsa-miR-4692	CLIP-seq
MIRT877052	hsa-miR-4720-3p	CLIP-seq
MIRT876972	hsa-miR-4726-3p	CLIP-seq
MIRT876974	hsa-miR-4742-5p	CLIP-seq
MIRT2196908	hsa-miR-4762-3p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877062	hsa-miR-4804-3p	CLIP-seq
MIRT2196909	hsa-miR-4804-5p	CLIP-seq
MIRT876976	hsa-miR-497	CLIP-seq
MIRT2196910	hsa-miR-514	CLIP-seq
MIRT2196911	hsa-miR-514b-3p	CLIP-seq
MIRT877066	hsa-miR-541	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877070	hsa-miR-575	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT876981	hsa-miR-590-5p	CLIP-seq
MIRT2196912	hsa-miR-608	CLIP-seq
MIRT876982	hsa-miR-646	CLIP-seq
MIRT877073	hsa-miR-654-5p	CLIP-seq
MIRT876983	hsa-miR-661	CLIP-seq
MIRT2442072	hsa-miR-4445	CLIP-seq
MIRT2442073	hsa-miR-4446-5p	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq
MIRT876919	hsa-miR-103a	CLIP-seq
MIRT876920	hsa-miR-107	CLIP-seq
MIRT876994	hsa-miR-1184	CLIP-seq
MIRT876995	hsa-miR-1205	CLIP-seq
MIRT877014	hsa-miR-3158-5p	CLIP-seq
MIRT877056	hsa-miR-4768-5p	CLIP-seq
MIRT877067	hsa-miR-545	CLIP-seq
MIRT877071	hsa-miR-583	CLIP-seq

6 Show/Hide all (6)

Transcription factor	Regulation	Reference
FOXM1	Unknown	23240008
HMGA1	Activation	22249617
LIN28A	Unknown	22467868
MSC	Repression	15213307
NANOG	Repression	17761754
NANOG	Unknown	19139263

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7667636
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	2188730
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	20360007
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IDA	20360007
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	20360007
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	7644510, 11298456, 15161933, 19289404, 28330616, 32296183, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007077	Process	Mitotic nuclear membrane disassembly	IDA	2188730
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	TAS	11139144
GO:0009314	Process	Response to radiation	IDA	21376736
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	20360007
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	21376736
GO:0045740	Process	Positive regulation of DNA replication	TAS
GO:0051087	Function	Protein-folding chaperone binding	IPI	22843495
GO:0051301	Process	Cell division	IEA
GO:0110032	Process	Positive regulation of G2/MI transition of meiotic cell cycle	IBA
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IEA

MIM	HGNC	e!Ensembl
116947	1725	ENSG00000164045

P30304

Protein name

M-phase inducer phosphatase 1 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25A)

Protein function

Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression (PubMed:12676925, PubMed:14559997, PubMed:1836978, PubMed:20360007). Directly dephosphorylates CDK1 and stimulates its kinase activity (PubMed:2036

PDB

1C25 , 8ROZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	369 → 476	Rhodanese-like domain	Domain
PF06617	M-inducer_phosp	86 → 328	M-phase inducer phosphatase	Family

Sequence

MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

Sequence length

524

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cell cycle	Transcription of E2F targets under negative control by DREAM complex
Cellular senescence	Polo-like kinase mediated events
Progesterone-mediated oocyte maturation	Activation of ATR in response to replication stress
MicroRNAs in cancer	Ub-specific processing proteases
Chemical carcinogenesis - receptor activation	Cyclin E associated events during G1/S transition
	Cyclin A/B1/B2 associated events during G2/M transition
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Cyclin A:Cdk2-associated events at S phase entry
	Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant polycystic liver disease	Likely pathogenic	rs3731499	RCV001844878	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 41022758	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (109)
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10573135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16715141, 29138515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27384875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16715141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22249617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11106571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12411323		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17483325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	22155366		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12960694, 25816175, 30106448, 31115494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12745652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29287594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10995786, 12045150, 16598773, 18566993, 19621387, 20605569, 20614206, 20724916, 21607584, 21670150, 21761201, 30443946, 30443958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10995786, 20614206, 23730206, 29287594, 34275890, 34990474, 35186236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19457610, 23730206, 36539837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11304565, 16715141, 17111124, 22843495, 9414655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23544130, 27644634, 28333141, 36539837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21291864, 27384875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35142956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11487274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10467347, 31281464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28607169		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31505105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31505105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22249617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27053344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27053344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19826040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24556688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11304565, 19826040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17283130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24993091, 30899377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33282948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25816175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25816175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37386808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32468021, 37173384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25218593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29544887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21618027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21618027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19948152, 20217459, 27485204, 28651608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30548945, 39830513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29624473, 29672635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	12745652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10754492, 12960694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	36483920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24556688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16854822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16854822, 26515730, 32024878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16854822, 26515730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12738732, 15534860, 18204780, 22705122, 25909324, 26647881, 27644634, 28333141, 31293973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12738732, 18204780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15534860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25990966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11487274	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10754492, 9563496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12745652, 32048780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14767575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12960694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12745652, 12960694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12960694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10995786, 12045150, 16598773, 18566993, 19621387, 20228808, 20605569, 20614206, 20724916, 21607584, 21670150, 21761201, 30443946, 30443958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24993091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25816175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25218593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21291864, 27384875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10467347, 31281464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19013180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28951130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18073536, 19013180, 20228808, 22263797, 22467868, 28951130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31505105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19826040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10995786, 12045150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16598773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22249617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	24724603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37898408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10754492, 11304565, 11487274, 16715141, 17111124, 17283130, 19075563, 20614206, 22249617, 26714930, 28004354, 28333141, 28422979, 28951130, 9414655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11106571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10445853, 21145615, 23071577, 25990966, 30902389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31799646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31799646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10467347		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31281464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22843495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	23675485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	18949056, 22155366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	22155366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30646895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19013180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14673957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17604597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	25326518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31237025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29138515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11487274, 17111124, 28951130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30858545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23675485, 29672635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29624473	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28951130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23675485, 28873083, 29624473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10376964, 27983933, 30106448, 38613794, 9414655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	12085185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	12085185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32766313, 35091678, 36998242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29246203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10982822, 31505105, 34761581, 40197384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30021902		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
CDC25B	[]	5	["Cell cycle","Progesterone-mediated oocyte maturation","Cyclin A:Cdk2-associated events at S phase entry","Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models","Cyclin A\/B1\/B2 associated events during G2\/M transition"]	[]
LIN54	[]	5	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex"]	[]
LIN9	[]	5	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex"]	[]
LIN37	[]	5	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex"]	[]
LIN52	[]	5	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex"]	[]

CDC25A (cell division cycle 25A)

Bookmark This Gene