LIN37 (lin-37 DREAM MuvB core complex component)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55957
• Gene name: Lin-37 DREAM MuvB core complex component
• Gene symbol: LIN37
• Synonyms (NCBI Gene): F25965, ZK418.4, lin-37
• Chromosome: 19
• Chromosome location: 19q13.12
• Summary: This gene encodes a protein expressed in the eye. [provided by RefSeq, Jul 2008]

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041466	hsa-miR-193b-3p	CLASH	23622248
MIRT037602	hsa-miR-744-5p	CLASH	23622248
MIRT1110235	hsa-miR-1275	CLIP-seq
MIRT1110236	hsa-miR-3650	CLIP-seq
MIRT1110237	hsa-miR-4487	CLIP-seq
MIRT1110238	hsa-miR-4525	CLIP-seq
MIRT1110239	hsa-miR-4633-3p	CLIP-seq
MIRT1110240	hsa-miR-4665-5p	CLIP-seq
MIRT1110241	hsa-miR-4723-5p	CLIP-seq
MIRT1110242	hsa-miR-4731-5p	CLIP-seq
MIRT1110243	hsa-miR-625	CLIP-seq
MIRT1110244	hsa-miR-637	CLIP-seq
MIRT1110235	hsa-miR-1275	CLIP-seq
MIRT1110236	hsa-miR-3650	CLIP-seq
MIRT1110237	hsa-miR-4487	CLIP-seq
MIRT1110238	hsa-miR-4525	CLIP-seq
MIRT1110239	hsa-miR-4633-3p	CLIP-seq
MIRT1110240	hsa-miR-4665-5p	CLIP-seq
MIRT1110241	hsa-miR-4723-5p	CLIP-seq
MIRT1110242	hsa-miR-4731-5p	CLIP-seq
MIRT1110243	hsa-miR-625	CLIP-seq
MIRT1110244	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183
GO:0005654	Component	Nucleoplasm	TAS
GO:0010467	Process	Gene expression	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0031523	Component	Myb complex	IBA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045023	Process	G0 to G1 transition	IEA

Other IDs

• MIM: 621287
• HGNC: 33234
• e!Ensembl: ENSG00000267796

Protein

• UniProt ID: Q96GY3
• Protein name: Protein lin-37 homolog (Antolefinin)
• PDB: 7N40 , 7R1D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15306	LIN37	85 → 240	LIN37	Family

• Sequence:

  MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAA
  TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
  AWMRNSPSVRERECSPSSPLPPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRI
  PSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
  EMYERQ

• Sequence length: 246

Pathways

KEGG Pathway	Reactome Pathway
Cellular senescence	Transcription of E2F targets under negative control by DREAM complex
	G0 and Early G1
	Polo-like kinase mediated events
	Cyclin E associated events during G1/S transition
	G1/S-Specific Transcription
	Cyclin A:Cdk2-associated events at S phase entry

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LIN54 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . LIN9 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . LIN52 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . E2F5 6 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 6 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . E2F4 6 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 6 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition .

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LIN54	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
LIN9	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
LIN52	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
E2F5	0	[]	6	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
E2F4	0	[]	6	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesLIN54 Cardiovascular disease Linked via 1 of 5 related genesLIN54 Non-small-cell lung carcinoma Linked via 1 of 5 related genesE2F5 Lynch syndrome Linked via 1 of 5 related genesE2F4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["LIN54"]
Cardiovascular disease	1	["LIN54"]
Non-small-cell lung carcinoma	1	["E2F5"]
Lynch syndrome	1	["E2F4"]