LIN9 (lin-9 DREAM MuvB core complex component)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 286826
• Gene name: Lin-9 DREAM MuvB core complex component
• Gene symbol: LIN9
• Synonyms (NCBI Gene): BARA, BARPsv, Lin-9, TGS, TGS1, TGS2
• Chromosome: 1
• Chromosome location: 1q42.12
• Summary: This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell c

miRNA Show/Hide all (98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024654	hsa-miR-215-5p	Microarray	19074876
MIRT026672	hsa-miR-192-5p	Microarray	19074876
MIRT047967	hsa-miR-30c-5p	CLASH	23622248
MIRT715017	hsa-miR-3121-3p	HITS-CLIP	19536157
MIRT715016	hsa-miR-656-3p	HITS-CLIP	19536157
MIRT715015	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT715014	hsa-miR-337-3p	HITS-CLIP	19536157
MIRT679568	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT679567	hsa-miR-5586-3p	HITS-CLIP	23313552
MIRT679562	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT696236	hsa-miR-3975	HITS-CLIP	23313552
MIRT696235	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT696234	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT696233	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT696232	hsa-miR-3188	HITS-CLIP	23313552
MIRT679557	hsa-miR-661	HITS-CLIP	23313552
MIRT679556	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT679555	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT696231	hsa-miR-4316	HITS-CLIP	23313552
MIRT679568	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT679567	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT679566	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT679565	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT679564	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679563	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT679562	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT679561	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT679560	hsa-miR-4486	HITS-CLIP	23824327
MIRT679559	hsa-miR-4537	HITS-CLIP	23824327
MIRT679558	hsa-miR-4252	HITS-CLIP	23824327
MIRT679557	hsa-miR-661	HITS-CLIP	23824327
MIRT679556	hsa-miR-4649-5p	HITS-CLIP	23824327
MIRT679555	hsa-miR-6729-5p	HITS-CLIP	23824327
MIRT679554	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT679553	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT679552	hsa-miR-7703	HITS-CLIP	23824327
MIRT727300	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727299	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT715017	hsa-miR-3121-3p	HITS-CLIP	19536157
MIRT715016	hsa-miR-656-3p	HITS-CLIP	19536157
MIRT715015	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT715014	hsa-miR-337-3p	HITS-CLIP	19536157
MIRT679568	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT679567	hsa-miR-5586-3p	HITS-CLIP	23313552
MIRT679562	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT696236	hsa-miR-3975	HITS-CLIP	23313552
MIRT696235	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT696234	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT696233	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT696232	hsa-miR-3188	HITS-CLIP	23313552
MIRT679557	hsa-miR-661	HITS-CLIP	23313552
MIRT679556	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT679555	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT696231	hsa-miR-4316	HITS-CLIP	23313552
MIRT679568	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT679567	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT679566	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT679565	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT679564	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679563	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT679562	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT679561	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT679560	hsa-miR-4486	HITS-CLIP	23824327
MIRT679559	hsa-miR-4537	HITS-CLIP	23824327
MIRT679558	hsa-miR-4252	HITS-CLIP	23824327
MIRT679557	hsa-miR-661	HITS-CLIP	23824327
MIRT679556	hsa-miR-4649-5p	HITS-CLIP	23824327
MIRT679555	hsa-miR-6729-5p	HITS-CLIP	23824327
MIRT679554	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT679553	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT679552	hsa-miR-7703	HITS-CLIP	23824327
MIRT1110507	hsa-miR-3143	CLIP-seq
MIRT1110508	hsa-miR-3163	CLIP-seq
MIRT1110509	hsa-miR-323-3p	CLIP-seq
MIRT1110510	hsa-miR-4789-5p	CLIP-seq
MIRT1110511	hsa-miR-4803	CLIP-seq
MIRT2030875	hsa-miR-1305	CLIP-seq
MIRT2030876	hsa-miR-154	CLIP-seq
MIRT2030877	hsa-miR-205	CLIP-seq
MIRT2030878	hsa-miR-3065-5p	CLIP-seq
MIRT1110508	hsa-miR-3163	CLIP-seq
MIRT2030879	hsa-miR-421	CLIP-seq
MIRT2030880	hsa-miR-4326	CLIP-seq
MIRT2030881	hsa-miR-4659a-3p	CLIP-seq
MIRT2030882	hsa-miR-4659b-3p	CLIP-seq
MIRT2030883	hsa-miR-4795-3p	CLIP-seq
MIRT1110511	hsa-miR-4803	CLIP-seq
MIRT2030884	hsa-miR-548a-3p	CLIP-seq
MIRT2030885	hsa-miR-548e	CLIP-seq
MIRT2030886	hsa-miR-548f	CLIP-seq
MIRT2030887	hsa-miR-671-5p	CLIP-seq
MIRT2261535	hsa-miR-140-5p	CLIP-seq
MIRT2261536	hsa-miR-186	CLIP-seq
MIRT2030878	hsa-miR-3065-5p	CLIP-seq
MIRT2261537	hsa-miR-4276	CLIP-seq
MIRT2030884	hsa-miR-548a-3p	CLIP-seq
MIRT2030885	hsa-miR-548e	CLIP-seq
MIRT2030886	hsa-miR-548f	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IBA
GO:0005515	Function	Protein binding	IPI	17159899, 17531812, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0071897	Process	DNA biosynthetic process	IEA

Other IDs

• MIM: 609375
• HGNC: 30830
• e!Ensembl: ENSG00000183814

Protein

• UniProt ID: Q5TKA1
• Protein name: Protein lin-9 homolog (HuLin-9) (hLin-9) (Beta subunit-associated regulator of apoptosis) (TUDOR gene similar protein) (Type I interferon receptor beta chain-associated protein) (pRB-associated protein)
• Protein function: Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition. {ECO:0000269|PubMed:15538
• PDB: 6C48 , 7N40 , 7R1D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06584	DIRP	127 → 231	DIRP	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in thymus and testis. {ECO:0000269|PubMed:15538385}.
• Sequence:

  MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKR
  SRLFSDEDDRQINTRSPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHK
  WCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAF
  FEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRGVHDGLFTG
  QIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSRFFMTPPR
  LHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHI
  KKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQ
  GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEG
  GDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAFAANNTN
  RD

• Sequence length: 542

Pathways

KEGG Pathway	Reactome Pathway
Cellular senescence	Transcription of E2F targets under negative control by DREAM complex
	G0 and Early G1
	Polo-like kinase mediated events
	Cyclin E associated events during G1/S transition
	G1/S-Specific Transcription
	Cyclin A:Cdk2-associated events at S phase entry

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LIN54 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . LIN37 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . LIN52 7 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Polo-like kinase mediated events, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 7 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . E2F5 6 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 6 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition . E2F4 6 shared pathwaysCellular senescence, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, G0 and Early G1, Transcription of E2F targets under negative control by DREAM complex, G1/S-Specific Transcription Related via 6 shared pathways including Cellular senescence, Cyclin E associated events during G1/S transition .

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LIN54	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
LIN37	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
LIN52	0	[]	7	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Polo-like kinase mediated events","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
E2F5	0	[]	6	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]
E2F4	0	[]	6	["Cellular senescence","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","G0 and Early G1","Transcription of E2F targets under negative control by DREAM complex","G1\/S-Specific Transcription"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesLIN54 Cardiovascular disease Linked via 1 of 5 related genesLIN54 Non-small-cell lung carcinoma Linked via 1 of 5 related genesE2F5 Lynch syndrome Linked via 1 of 5 related genesE2F4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["LIN54"]
Cardiovascular disease	1	["LIN54"]
Non-small-cell lung carcinoma	1	["E2F5"]
Lynch syndrome	1	["E2F4"]