Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	911
Gene name	CD1c molecule
Gene symbol	CD1C
Synonyms (NCBI Gene)	BDCA1CD1CD1AR7
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation o

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT874012	hsa-miR-190	CLIP-seq
MIRT874013	hsa-miR-190b	CLIP-seq
MIRT874014	hsa-miR-216a	CLIP-seq
MIRT874015	hsa-miR-3121-3p	CLIP-seq
MIRT874016	hsa-miR-3126-5p	CLIP-seq
MIRT874017	hsa-miR-3173-3p	CLIP-seq
MIRT874018	hsa-miR-3662	CLIP-seq
MIRT874019	hsa-miR-3935	CLIP-seq
MIRT874020	hsa-miR-4307	CLIP-seq
MIRT874021	hsa-miR-4419a	CLIP-seq
MIRT874022	hsa-miR-4428	CLIP-seq
MIRT874023	hsa-miR-4476	CLIP-seq
MIRT874024	hsa-miR-4477b	CLIP-seq
MIRT874025	hsa-miR-4510	CLIP-seq
MIRT874026	hsa-miR-4684-3p	CLIP-seq
MIRT874027	hsa-miR-579	CLIP-seq
MIRT874028	hsa-miR-587	CLIP-seq
MIRT874023	hsa-miR-4476	CLIP-seq
MIRT874026	hsa-miR-4684-3p	CLIP-seq
MIRT2196186	hsa-miR-124	CLIP-seq
MIRT2196187	hsa-miR-331-5p	CLIP-seq
MIRT2196188	hsa-miR-4678	CLIP-seq
MIRT2196189	hsa-miR-4686	CLIP-seq
MIRT2196190	hsa-miR-4793-3p	CLIP-seq
MIRT2196191	hsa-miR-506	CLIP-seq

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002286	Process	T cell activation involved in immune response	IDA	21167756
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005615	Component	Extracellular space	IBA
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2447586, 2701945
GO:0006955	Process	Immune response	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030883	Function	Endogenous lipid antigen binding	IBA
GO:0030883	Function	Endogenous lipid antigen binding	IDA	21167756
GO:0030884	Function	Exogenous lipid antigen binding	IBA
GO:0030884	Function	Exogenous lipid antigen binding	IDA	21167756
GO:0048006	Process	Antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IBA
GO:0048007	Process	Antigen processing and presentation, exogenous lipid antigen via MHC class Ib	IBA
GO:0051861	Function	Glycolipid binding	IDA	21167756
GO:0071723	Function	Lipopeptide binding	IBA
GO:0071723	Function	Lipopeptide binding	IDA	21167756

MIM	HGNC	e!Ensembl
188340	1636	ENSG00000158481

P29017

Protein name

T-cell surface glycoprotein CD1c (CD antigen CD1c)

Protein function

Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. {ECO:0000269|PubMed:10786796, ECO:0000269|PubMed:10890914, ECO:0000269|PubMed:10899914, ECO:00

PDB

3OV6 , 4ONO , 5C9J , 6C09 , 6C15

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07654	C1-set	208 → 287	Immunoglobulin C1-set domain	Domain
PF16497	MHC_I_3	1 → 199	MHC-I family domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Sequence

MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDS
ESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGC
ELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNL
IRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWM
RNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF
SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL

Sequence length

333

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Tight junction	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Hematopoietic cell lineage
Amoebiasis

CD1C (CD1c molecule)

Bookmark This Gene