Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	858
Gene name	Caveolin 2
Gene symbol	CAV2
Synonyms (NCBI Gene)	CAV
Chromosome	7
Chromosome location	7q31.2
Summary	The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control a

398 Show/Hide all (398)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006655	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	21807947
MIRT006655	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	21807947
MIRT006655	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	21807947
MIRT006655	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	21807947
MIRT028136	hsa-miR-93-5p	Sequencing	20371350
MIRT029751	hsa-miR-26b-5p	Microarray	19088304
MIRT675823	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT659808	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT659807	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT659806	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT659805	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT659804	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT659803	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT659802	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT659801	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT659800	hsa-miR-1976	HITS-CLIP	23824327
MIRT659799	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT675822	hsa-miR-4279	HITS-CLIP	23824327
MIRT675821	hsa-miR-498	HITS-CLIP	23824327
MIRT659809	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT659808	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT659807	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT659806	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT659805	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT659804	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT659803	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT659802	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT659801	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT659800	hsa-miR-1976	HITS-CLIP	23824327
MIRT659799	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT659798	hsa-miR-3199	HITS-CLIP	23824327
MIRT659797	hsa-miR-8052	HITS-CLIP	23824327
MIRT659796	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT659795	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT675823	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT659808	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT659807	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT659806	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT659805	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT659804	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT659803	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT659802	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT659801	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT659800	hsa-miR-1976	HITS-CLIP	23824327
MIRT659799	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT675822	hsa-miR-4279	HITS-CLIP	23824327
MIRT675821	hsa-miR-498	HITS-CLIP	23824327
MIRT659809	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT659808	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT659807	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT659806	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT659805	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT659804	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT659803	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT659802	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT659801	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT659800	hsa-miR-1976	HITS-CLIP	23824327
MIRT659799	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT659798	hsa-miR-3199	HITS-CLIP	23824327
MIRT659797	hsa-miR-8052	HITS-CLIP	23824327
MIRT659796	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT659795	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT864530	hsa-miR-105	CLIP-seq
MIRT864531	hsa-miR-1202	CLIP-seq
MIRT864532	hsa-miR-1254	CLIP-seq
MIRT864533	hsa-miR-1290	CLIP-seq
MIRT864534	hsa-miR-1305	CLIP-seq
MIRT864535	hsa-miR-130a	CLIP-seq
MIRT864536	hsa-miR-130b	CLIP-seq
MIRT864537	hsa-miR-148a	CLIP-seq
MIRT864538	hsa-miR-148b	CLIP-seq
MIRT864539	hsa-miR-152	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT864541	hsa-miR-216a	CLIP-seq
MIRT864542	hsa-miR-301a	CLIP-seq
MIRT864543	hsa-miR-301b	CLIP-seq
MIRT864544	hsa-miR-3116	CLIP-seq
MIRT864545	hsa-miR-3129-3p	CLIP-seq
MIRT864546	hsa-miR-3167	CLIP-seq
MIRT864547	hsa-miR-330-3p	CLIP-seq
MIRT864548	hsa-miR-3622b-5p	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT864550	hsa-miR-3666	CLIP-seq
MIRT864551	hsa-miR-3937	CLIP-seq
MIRT864552	hsa-miR-3972	CLIP-seq
MIRT864553	hsa-miR-4264	CLIP-seq
MIRT864554	hsa-miR-4289	CLIP-seq
MIRT864555	hsa-miR-4295	CLIP-seq
MIRT864556	hsa-miR-4423-5p	CLIP-seq
MIRT864557	hsa-miR-4506	CLIP-seq
MIRT864558	hsa-miR-454	CLIP-seq
MIRT864559	hsa-miR-4670-3p	CLIP-seq
MIRT864560	hsa-miR-4698	CLIP-seq
MIRT864561	hsa-miR-4699-3p	CLIP-seq
MIRT864562	hsa-miR-4709-5p	CLIP-seq
MIRT864563	hsa-miR-4715-3p	CLIP-seq
MIRT864564	hsa-miR-4728-3p	CLIP-seq
MIRT864565	hsa-miR-4747-5p	CLIP-seq
MIRT864566	hsa-miR-4755-3p	CLIP-seq
MIRT864567	hsa-miR-4773	CLIP-seq
MIRT864568	hsa-miR-4797-3p	CLIP-seq
MIRT864569	hsa-miR-548a-3p	CLIP-seq
MIRT864570	hsa-miR-548e	CLIP-seq
MIRT864571	hsa-miR-548f	CLIP-seq
MIRT864572	hsa-miR-552	CLIP-seq
MIRT864573	hsa-miR-568	CLIP-seq
MIRT864574	hsa-miR-607	CLIP-seq
MIRT864575	hsa-miR-628-5p	CLIP-seq
MIRT864576	hsa-miR-629	CLIP-seq
MIRT864577	hsa-miR-633	CLIP-seq
MIRT864578	hsa-miR-764	CLIP-seq
MIRT864579	hsa-miR-876-5p	CLIP-seq
MIRT864580	hsa-miR-890	CLIP-seq
MIRT864531	hsa-miR-1202	CLIP-seq
MIRT1956254	hsa-miR-1279	CLIP-seq
MIRT1956255	hsa-miR-147	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT1956256	hsa-miR-218	CLIP-seq
MIRT1956257	hsa-miR-3140-3p	CLIP-seq
MIRT864548	hsa-miR-3622b-5p	CLIP-seq
MIRT1956258	hsa-miR-3658	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT1956259	hsa-miR-380	CLIP-seq
MIRT864551	hsa-miR-3937	CLIP-seq
MIRT864552	hsa-miR-3972	CLIP-seq
MIRT864553	hsa-miR-4264	CLIP-seq
MIRT1956260	hsa-miR-4282	CLIP-seq
MIRT864554	hsa-miR-4289	CLIP-seq
MIRT1956261	hsa-miR-433	CLIP-seq
MIRT864556	hsa-miR-4423-5p	CLIP-seq
MIRT1956262	hsa-miR-4495	CLIP-seq
MIRT864560	hsa-miR-4698	CLIP-seq
MIRT864566	hsa-miR-4755-3p	CLIP-seq
MIRT1956263	hsa-miR-4772-3p	CLIP-seq
MIRT864568	hsa-miR-4797-3p	CLIP-seq
MIRT1956264	hsa-miR-548ag	CLIP-seq
MIRT1956265	hsa-miR-548ai	CLIP-seq
MIRT1956266	hsa-miR-548m	CLIP-seq
MIRT1956267	hsa-miR-627	CLIP-seq
MIRT864577	hsa-miR-633	CLIP-seq
MIRT1956268	hsa-miR-636	CLIP-seq
MIRT1956269	hsa-miR-924	CLIP-seq
MIRT2193854	hsa-miR-106a	CLIP-seq
MIRT2193855	hsa-miR-106b	CLIP-seq
MIRT864531	hsa-miR-1202	CLIP-seq
MIRT2193856	hsa-miR-1267	CLIP-seq
MIRT2193857	hsa-miR-150	CLIP-seq
MIRT2193858	hsa-miR-17	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT2193859	hsa-miR-20a	CLIP-seq
MIRT2193860	hsa-miR-20b	CLIP-seq
MIRT2193861	hsa-miR-24	CLIP-seq
MIRT2193862	hsa-miR-302a	CLIP-seq
MIRT2193863	hsa-miR-302b	CLIP-seq
MIRT2193864	hsa-miR-302c	CLIP-seq
MIRT2193865	hsa-miR-302d	CLIP-seq
MIRT2193866	hsa-miR-302e	CLIP-seq
MIRT864548	hsa-miR-3622b-5p	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT2193867	hsa-miR-372	CLIP-seq
MIRT2193868	hsa-miR-373	CLIP-seq
MIRT864551	hsa-miR-3937	CLIP-seq
MIRT864552	hsa-miR-3972	CLIP-seq
MIRT2193869	hsa-miR-4284	CLIP-seq
MIRT1956261	hsa-miR-433	CLIP-seq
MIRT864556	hsa-miR-4423-5p	CLIP-seq
MIRT2193870	hsa-miR-4731-5p	CLIP-seq
MIRT864566	hsa-miR-4755-3p	CLIP-seq
MIRT2193871	hsa-miR-4757-5p	CLIP-seq
MIRT1956263	hsa-miR-4772-3p	CLIP-seq
MIRT864567	hsa-miR-4773	CLIP-seq
MIRT2193872	hsa-miR-5095	CLIP-seq
MIRT2193873	hsa-miR-512-3p	CLIP-seq
MIRT2193874	hsa-miR-519d	CLIP-seq
MIRT2193875	hsa-miR-520a-3p	CLIP-seq
MIRT2193876	hsa-miR-520b	CLIP-seq
MIRT2193877	hsa-miR-520c-3p	CLIP-seq
MIRT2193878	hsa-miR-520d-3p	CLIP-seq
MIRT2193879	hsa-miR-520e	CLIP-seq
MIRT2193880	hsa-miR-520g	CLIP-seq
MIRT2193881	hsa-miR-520h	CLIP-seq
MIRT2193882	hsa-miR-640	CLIP-seq
MIRT2193883	hsa-miR-93	CLIP-seq
MIRT2385556	hsa-miR-221	CLIP-seq
MIRT2385557	hsa-miR-222	CLIP-seq
MIRT2193861	hsa-miR-24	CLIP-seq
MIRT2385558	hsa-miR-28-3p	CLIP-seq
MIRT2385559	hsa-miR-3200-3p	CLIP-seq
MIRT2385560	hsa-miR-4263	CLIP-seq
MIRT864553	hsa-miR-4264	CLIP-seq
MIRT2385561	hsa-miR-4265	CLIP-seq
MIRT2193869	hsa-miR-4284	CLIP-seq
MIRT2385562	hsa-miR-4296	CLIP-seq
MIRT2385563	hsa-miR-4300	CLIP-seq
MIRT2385564	hsa-miR-4305	CLIP-seq
MIRT2385565	hsa-miR-4322	CLIP-seq
MIRT2385566	hsa-miR-4422	CLIP-seq
MIRT2385567	hsa-miR-4633-3p	CLIP-seq
MIRT2385568	hsa-miR-4648	CLIP-seq
MIRT2385569	hsa-miR-4654	CLIP-seq
MIRT864559	hsa-miR-4670-3p	CLIP-seq
MIRT2385570	hsa-miR-4724-3p	CLIP-seq
MIRT2385571	hsa-miR-4769-5p	CLIP-seq
MIRT1956263	hsa-miR-4772-3p	CLIP-seq
MIRT864567	hsa-miR-4773	CLIP-seq
MIRT2385572	hsa-miR-4775	CLIP-seq
MIRT864568	hsa-miR-4797-3p	CLIP-seq
MIRT2385573	hsa-miR-548l	CLIP-seq
MIRT2385574	hsa-miR-576-5p	CLIP-seq
MIRT2385575	hsa-miR-606	CLIP-seq
MIRT2385576	hsa-miR-642b	CLIP-seq
MIRT2385577	hsa-miR-920	CLIP-seq
MIRT864530	hsa-miR-105	CLIP-seq
MIRT2427101	hsa-miR-1226	CLIP-seq
MIRT2427102	hsa-miR-1245b-5p	CLIP-seq
MIRT864535	hsa-miR-130a	CLIP-seq
MIRT864536	hsa-miR-130b	CLIP-seq
MIRT2427103	hsa-miR-145	CLIP-seq
MIRT1956255	hsa-miR-147	CLIP-seq
MIRT864537	hsa-miR-148a	CLIP-seq
MIRT864538	hsa-miR-148b	CLIP-seq
MIRT864539	hsa-miR-152	CLIP-seq
MIRT2427104	hsa-miR-1910	CLIP-seq
MIRT2427105	hsa-miR-197	CLIP-seq
MIRT2427106	hsa-miR-2053	CLIP-seq
MIRT864541	hsa-miR-216a	CLIP-seq
MIRT2427107	hsa-miR-217	CLIP-seq
MIRT2385556	hsa-miR-221	CLIP-seq
MIRT2385557	hsa-miR-222	CLIP-seq
MIRT2385558	hsa-miR-28-3p	CLIP-seq
MIRT864542	hsa-miR-301a	CLIP-seq
MIRT864543	hsa-miR-301b	CLIP-seq
MIRT2427108	hsa-miR-3065-5p	CLIP-seq
MIRT2427109	hsa-miR-3121-3p	CLIP-seq
MIRT1956257	hsa-miR-3140-3p	CLIP-seq
MIRT2427110	hsa-miR-3142	CLIP-seq
MIRT2427111	hsa-miR-3163	CLIP-seq
MIRT2427112	hsa-miR-3180-5p	CLIP-seq
MIRT2385559	hsa-miR-3200-3p	CLIP-seq
MIRT2427113	hsa-miR-340	CLIP-seq
MIRT2427114	hsa-miR-3646	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT864550	hsa-miR-3666	CLIP-seq
MIRT2427115	hsa-miR-369-3p	CLIP-seq
MIRT2427116	hsa-miR-374a	CLIP-seq
MIRT2427117	hsa-miR-374b	CLIP-seq
MIRT2427118	hsa-miR-3907	CLIP-seq
MIRT2427119	hsa-miR-409-5p	CLIP-seq
MIRT2427120	hsa-miR-421	CLIP-seq
MIRT2385560	hsa-miR-4263	CLIP-seq
MIRT864553	hsa-miR-4264	CLIP-seq
MIRT2385561	hsa-miR-4265	CLIP-seq
MIRT864554	hsa-miR-4289	CLIP-seq
MIRT864555	hsa-miR-4295	CLIP-seq
MIRT2385562	hsa-miR-4296	CLIP-seq
MIRT2385563	hsa-miR-4300	CLIP-seq
MIRT2385565	hsa-miR-4322	CLIP-seq
MIRT2427121	hsa-miR-4418	CLIP-seq
MIRT2385566	hsa-miR-4422	CLIP-seq
MIRT2427122	hsa-miR-4477a	CLIP-seq
MIRT2427123	hsa-miR-4496	CLIP-seq
MIRT2427124	hsa-miR-4528	CLIP-seq
MIRT864558	hsa-miR-454	CLIP-seq
MIRT2385567	hsa-miR-4633-3p	CLIP-seq
MIRT2385568	hsa-miR-4648	CLIP-seq
MIRT2385569	hsa-miR-4654	CLIP-seq
MIRT864559	hsa-miR-4670-3p	CLIP-seq
MIRT864561	hsa-miR-4699-3p	CLIP-seq
MIRT2427125	hsa-miR-4705	CLIP-seq
MIRT2385570	hsa-miR-4724-3p	CLIP-seq
MIRT2427126	hsa-miR-4729	CLIP-seq
MIRT2427127	hsa-miR-4733-3p	CLIP-seq
MIRT2385571	hsa-miR-4769-5p	CLIP-seq
MIRT864567	hsa-miR-4773	CLIP-seq
MIRT2385572	hsa-miR-4775	CLIP-seq
MIRT864568	hsa-miR-4797-3p	CLIP-seq
MIRT2427128	hsa-miR-4803	CLIP-seq
MIRT2427129	hsa-miR-494	CLIP-seq
MIRT2427130	hsa-miR-509-3-5p	CLIP-seq
MIRT2427131	hsa-miR-509-5p	CLIP-seq
MIRT2427132	hsa-miR-520d-5p	CLIP-seq
MIRT2427133	hsa-miR-524-5p	CLIP-seq
MIRT2427134	hsa-miR-548c-3p	CLIP-seq
MIRT864573	hsa-miR-568	CLIP-seq
MIRT2385574	hsa-miR-576-5p	CLIP-seq
MIRT2385575	hsa-miR-606	CLIP-seq
MIRT2385576	hsa-miR-642b	CLIP-seq
MIRT2427135	hsa-miR-656	CLIP-seq
MIRT2427136	hsa-miR-665	CLIP-seq
MIRT2427137	hsa-miR-9	CLIP-seq
MIRT2385577	hsa-miR-920	CLIP-seq
MIRT2385559	hsa-miR-3200-3p	CLIP-seq
MIRT2385570	hsa-miR-4724-3p	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT864531	hsa-miR-1202	CLIP-seq
MIRT2193856	hsa-miR-1267	CLIP-seq
MIRT1956254	hsa-miR-1279	CLIP-seq
MIRT2497146	hsa-miR-1303	CLIP-seq
MIRT2497147	hsa-miR-1914	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT2497148	hsa-miR-203	CLIP-seq
MIRT2497149	hsa-miR-2052	CLIP-seq
MIRT2193861	hsa-miR-24	CLIP-seq
MIRT2385558	hsa-miR-28-3p	CLIP-seq
MIRT2497150	hsa-miR-3123	CLIP-seq
MIRT2497151	hsa-miR-3135	CLIP-seq
MIRT2497152	hsa-miR-3152-3p	CLIP-seq
MIRT2497153	hsa-miR-3156-5p	CLIP-seq
MIRT2427111	hsa-miR-3163	CLIP-seq
MIRT2497154	hsa-miR-3194-3p	CLIP-seq
MIRT864548	hsa-miR-3622b-5p	CLIP-seq
MIRT1956258	hsa-miR-3658	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT2497155	hsa-miR-3674	CLIP-seq
MIRT2497156	hsa-miR-3925-5p	CLIP-seq
MIRT864551	hsa-miR-3937	CLIP-seq
MIRT864552	hsa-miR-3972	CLIP-seq
MIRT2385560	hsa-miR-4263	CLIP-seq
MIRT2193869	hsa-miR-4284	CLIP-seq
MIRT2385564	hsa-miR-4305	CLIP-seq
MIRT2497157	hsa-miR-4328	CLIP-seq
MIRT2385566	hsa-miR-4422	CLIP-seq
MIRT864556	hsa-miR-4423-5p	CLIP-seq
MIRT2497158	hsa-miR-4436b-3p	CLIP-seq
MIRT2497159	hsa-miR-4477b	CLIP-seq
MIRT2497160	hsa-miR-4481	CLIP-seq
MIRT2497161	hsa-miR-4521	CLIP-seq
MIRT2497162	hsa-miR-4668-3p	CLIP-seq
MIRT864560	hsa-miR-4698	CLIP-seq
MIRT864563	hsa-miR-4715-3p	CLIP-seq
MIRT2497163	hsa-miR-4745-5p	CLIP-seq
MIRT864566	hsa-miR-4755-3p	CLIP-seq
MIRT2497164	hsa-miR-4758-5p	CLIP-seq
MIRT2497165	hsa-miR-4760-5p	CLIP-seq
MIRT2497166	hsa-miR-4761-3p	CLIP-seq
MIRT1956263	hsa-miR-4772-3p	CLIP-seq
MIRT2385572	hsa-miR-4775	CLIP-seq
MIRT2427128	hsa-miR-4803	CLIP-seq
MIRT2497167	hsa-miR-539	CLIP-seq
MIRT1956264	hsa-miR-548ag	CLIP-seq
MIRT1956265	hsa-miR-548ai	CLIP-seq
MIRT2497168	hsa-miR-548n	CLIP-seq
MIRT2497169	hsa-miR-548t	CLIP-seq
MIRT864572	hsa-miR-552	CLIP-seq
MIRT2497170	hsa-miR-561	CLIP-seq
MIRT2385574	hsa-miR-576-5p	CLIP-seq
MIRT2497171	hsa-miR-593	CLIP-seq
MIRT2385575	hsa-miR-606	CLIP-seq
MIRT2385576	hsa-miR-642b	CLIP-seq
MIRT864578	hsa-miR-764	CLIP-seq
MIRT2497172	hsa-miR-944	CLIP-seq
MIRT864531	hsa-miR-1202	CLIP-seq
MIRT2427102	hsa-miR-1245b-5p	CLIP-seq
MIRT2193856	hsa-miR-1267	CLIP-seq
MIRT864540	hsa-miR-1915	CLIP-seq
MIRT2497148	hsa-miR-203	CLIP-seq
MIRT2497149	hsa-miR-2052	CLIP-seq
MIRT2427106	hsa-miR-2053	CLIP-seq
MIRT2193861	hsa-miR-24	CLIP-seq
MIRT2385558	hsa-miR-28-3p	CLIP-seq
MIRT2427109	hsa-miR-3121-3p	CLIP-seq
MIRT2497151	hsa-miR-3135	CLIP-seq
MIRT2427110	hsa-miR-3142	CLIP-seq
MIRT2427111	hsa-miR-3163	CLIP-seq
MIRT2497154	hsa-miR-3194-3p	CLIP-seq
MIRT864548	hsa-miR-3622b-5p	CLIP-seq
MIRT864549	hsa-miR-3662	CLIP-seq
MIRT864551	hsa-miR-3937	CLIP-seq
MIRT864552	hsa-miR-3972	CLIP-seq
MIRT2385560	hsa-miR-4263	CLIP-seq
MIRT2193869	hsa-miR-4284	CLIP-seq
MIRT2497157	hsa-miR-4328	CLIP-seq
MIRT864556	hsa-miR-4423-5p	CLIP-seq
MIRT2497158	hsa-miR-4436b-3p	CLIP-seq
MIRT2497159	hsa-miR-4477b	CLIP-seq
MIRT2497160	hsa-miR-4481	CLIP-seq
MIRT2427123	hsa-miR-4496	CLIP-seq
MIRT2497161	hsa-miR-4521	CLIP-seq
MIRT2497162	hsa-miR-4668-3p	CLIP-seq
MIRT864560	hsa-miR-4698	CLIP-seq
MIRT2497163	hsa-miR-4745-5p	CLIP-seq
MIRT2677440	hsa-miR-4753-3p	CLIP-seq
MIRT864566	hsa-miR-4755-3p	CLIP-seq
MIRT2497164	hsa-miR-4758-5p	CLIP-seq
MIRT2497166	hsa-miR-4761-3p	CLIP-seq
MIRT1956263	hsa-miR-4772-3p	CLIP-seq
MIRT2385572	hsa-miR-4775	CLIP-seq
MIRT2427128	hsa-miR-4803	CLIP-seq
MIRT2427129	hsa-miR-494	CLIP-seq
MIRT1956264	hsa-miR-548ag	CLIP-seq
MIRT1956265	hsa-miR-548ai	CLIP-seq
MIRT864572	hsa-miR-552	CLIP-seq
MIRT2385574	hsa-miR-576-5p	CLIP-seq
MIRT2497171	hsa-miR-593	CLIP-seq
MIRT2385575	hsa-miR-606	CLIP-seq
MIRT2385576	hsa-miR-642b	CLIP-seq
MIRT864578	hsa-miR-764	CLIP-seq

71 Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IBA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0002095	Component	Caveolar macromolecular signaling complex	IEA
GO:0005515	Function	Protein binding	IPI	10212252, 11294831, 15703204, 16799092, 19931615, 24013648, 24658140, 25556234, 31980649, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005886	Component	Plasma membrane	IDA	8552590, 12743374, 15569306, 15788404
GO:0005886	Component	Plasma membrane	IEA
GO:0005901	Component	Caveola	IDA	8552590, 9361015, 15703204, 18081315, 24013648, 25556234
GO:0005901	Component	Caveola	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	12091389
GO:0005925	Component	Focal adhesion	IEA
GO:0006906	Process	Vesicle fusion	IDA	12743374
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	ISS
GO:0007029	Process	Endoplasmic reticulum organization	IEA
GO:0007029	Process	Endoplasmic reticulum organization	ISS
GO:0007088	Process	Regulation of mitotic nuclear division	IDA	18081315
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	8552590
GO:0008283	Process	Cell population proliferation	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	20455999
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0014859	Process	Negative regulation of skeletal muscle cell proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016050	Process	Vesicle organization	IDA	12743374
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	IGI	21047970
GO:0019076	Process	Viral release from host cell	IMP	25556234
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030133	Component	Transport vesicle	IDA
GO:0030154	Process	Cell differentiation	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	22792322
GO:0031748	Function	D1 dopamine receptor binding	IPI	15569306
GO:0032795	Function	Heterotrimeric G-protein binding	IDA	8552590
GO:0032991	Component	Protein-containing complex	IDA	24013648
GO:0032991	Component	Protein-containing complex	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	8552590
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	20455999
GO:0044794	Process	Host-mediated activation of viral process	IMP	25556234
GO:0044853	Component	Plasma membrane raft	IDA	15569306
GO:0045121	Component	Membrane raft	IDA	11294831
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048278	Process	Vesicle docking	IDA	12743374
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18081315
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048741	Process	Skeletal muscle fiber development	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060161	Process	Positive regulation of dopamine receptor signaling pathway	IMP	15569306
GO:0070836	Process	Caveola assembly	IBA
GO:0070836	Process	Caveola assembly	IDA	12743374
GO:0070836	Process	Caveola assembly	IEA
GO:0070836	Process	Caveola assembly	IMP	12633858
GO:0071711	Process	Basement membrane organization	IEA
GO:0097110	Function	Scaffold protein binding	IEA

MIM	HGNC	e!Ensembl
601048	1528	ENSG00000105971

P51636

Protein name

Caveolin-2

Protein function

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driv

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01146	Caveolin	16 → 160	Caveolin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts. {ECO:0000269|PubMed:9361015}.

Sequence

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

Sequence length

162

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Endocytosis	Extra-nuclear estrogen signaling
Focal adhesion
Prion disease
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (15)
AMYOTROPHIC LATERAL SCLEROSIS	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	33264630, 36937187	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	17379860	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	20062060, 28416818, 29892015, 39537608	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	29531354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	29531354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	30054594, 31959993, 35841873, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	CTD, Disgenet CTD, Disgenet	20835238	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	20835238, 25173105, 29891935, 33627673, 37386247, 38382466, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	33975060	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DUCTAL ADENOCARCINOMA	—	GWAS catalog	33975060	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	15583422	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (96)
Alzheimer Disease	Alzheimer disease	Pubtator	22142809, 29343717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	22422066, 29852412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14522500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20062060, 24239840		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	20062060		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	20062060, 24239840	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30543678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30707892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	15968725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24581832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29850392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15305200, 15583422, 21807947, 25623282, 26902604, 28857238, 29207674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15305200, 18612310, 21584795, 27993161, 35132081, 37432976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31642198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18612310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21584795	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29850392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26043775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	GWASCAT_DG	29531354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	29665111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29575396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15069532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12414992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16207479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35352485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23454155, 26043775, 30288056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	29296972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29557990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29557990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26047157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26047157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30543678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21178094, 36347081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30543678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21178094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	26480297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17671707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17671707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	29544690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12782592		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	29544690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18497548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	22128235, 25525164, 26015768		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	23743525, 25103269, 25525164, 26015768	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20835238, 21321670, 21873608, 22128235, 23743525, 24518671, 24572674, 25414181, 25525164, 25637523, 26015768, 27297022, 29104244, 33726755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASDB_DG	20835238		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Open-Angle	Glaucoma	CTD_human_DG	20835238		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20835238, 21321670, 21873608, 22128235, 22876122, 23743525, 24572674, 25525164, 27297022, 28832686, 29111846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	CTD_human_DG	20835238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15273741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15273741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30269377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30269377, 31284021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	27168348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	15968725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	30588629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23743525, 28832686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29850392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29850392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29850392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15305200, 21807947, 25623282, 26902604, 28857238, 29207674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17671707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30288056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29850392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29978477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15583422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10049753, 21807947, 28386695, 30288056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16244790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25623282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30080864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	29544690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	15968725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15095482, 21489836, 22128235, 27168348, 28865960, 29207674, 29850392, 31831780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14978757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	29246857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16292351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29978477		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	30046008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	20062060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15583422		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	30288056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23454155, 26043775, 30288056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16055201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17379860		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	17379860		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary Open Angle Glaucoma	Open Angle Glaucoma	CTD_human_DG	20835238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17671707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17671707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36830672	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	29420626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31642198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18612310, 25623282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30311774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	24572674, 25525164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NEURL1	3	["Cardiac arrhythmia","Cardiac embolism","Cardioembolic stroke"]	0	[]	5	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Cardiac arrhythmia)","GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
NACA	2	["Cardiac arrhythmia","Pancreatic cancer"]	0	[]	4	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Cardiac arrhythmia)","GWAS catalog (Pancreatic cancer)"]
KCNN3	4	["Cardiac arrhythmia","Cardiac embolism","Cardioembolic stroke","Glaucoma"]	0	[]	6	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Cardiac arrhythmia)","GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)","GWAS catalog (Glaucoma)"]
PPFIA4	2	["Cardiac arrhythmia","Cardioembolic stroke"]	0	[]	4	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Cardiac arrhythmia)","GWAS catalog (Cardioembolic stroke)"]
CAV1	3	["Cardiac arrhythmia","Cardioembolic stroke","Glaucoma"]	7	["Endocytosis","Focal adhesion","Prion disease","Bacterial invasion of epithelial cells","Proteoglycans in cancer","Fluid shear stress and atherosclerosis","Extra-nuclear estrogen signaling"]	11	["Disgenet (Amyotrophic lateral sclerosis)","GWAS catalog (Amyotrophic lateral sclerosis)","ClinGen (Amyotrophic lateral sclerosis)","CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Cardiac arrhythmia)","GWAS catalog (Cardioembolic stroke)","GWAS catalog (Glaucoma)","Disgenet (Glaucoma)","CTD (Glaucoma)","Disgenet (Open angle glaucoma)"]

CAV2 (caveolin 2)

Bookmark This Gene