C6orf118 (chromosome 6 open reading frame 118)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 168090
Gene name Chromosome 6 open reading frame 118
Gene symbol C6orf118
Synonyms (NCBI Gene)
bA85G2.1dJ416F21.2
Chromosome 6
Chromosome location 6q27
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023772 hsa-miR-1-3p Microarray 18668037
MIRT2190048 hsa-miR-193a-3p CLIP-seq
MIRT2190049 hsa-miR-193b CLIP-seq
MIRT2190050 hsa-miR-3187-3p CLIP-seq
MIRT2190051 hsa-miR-3692 CLIP-seq
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T5N4
Protein name Uncharacterized protein C6orf118
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15739 TSNAXIP1_N 246 → 356 Translin-associated factor X-interacting N-terminus Family
Sequence 
MAEEREPELYLKWKHCETPGVKTLCNLKHCETPGVKTLCNLKKLLNRLQKDHREDVYLYI
SGHLNPNKLYQPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVP
SEAQDTPLFRYLNPQASLSHTSEEDFLPVEAVREGKEEKKGGPPGRGPPGWRRREELRLP
DLKVLCYQEAGSRGTRDRHHYVSSYLAGATSADRYRMFLRFQKEVLAKQDLLKNDFTGSK
AAAGHERKLQQELQKICTCSPQQFNRLHVFGKVFEDICNSSLIFGDLLKKVKDEYELYMA
TLLESQPAAQYEALLAQLKALGQRPVKTADMDLAREELRMLVTATKAALEQNDRLRSELE
MEVALLQSAKERSESSEKHIIDENRLTLTEKVEKKRCEILSKWDEIQALEKEIKTTLVHT
GISDITENRIKSIEHEAIQLETENMILKKKIKGPLEIYQGICKIRGNRR
Sequence length 469
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
32
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (32)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 39023044
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA — GWAS catalog 24824216, 25918132
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 36137488
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — GWAS catalog 30217971, 31926635
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
AKAP7 2 shared diseasesMultiple myeloma, Peptic ulcer disease 2 shared evidence sourcesGWAS catalog (Multiple myeloma), GWAS catalog (Peptic ulcer disease) Related via 2 shared diseases including Multiple myeloma, Peptic ulcer disease — evidence mostly GWAS catalog. KLC1 2 shared diseasesObsessive-compulsive disorder, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Obsessive-compulsive disorder, Psychiatric disorders — evidence mostly GWAS catalog. ZNF169 2 shared diseasesPeptic ulcer disease, Peripheral arterial disease 2 shared evidence sourcesGWAS catalog (Peptic ulcer disease), GWAS catalog (Peripheral arterial disease) Related via 2 shared diseases including Peptic ulcer disease, Peripheral arterial disease — evidence mostly GWAS catalog. SLC39A12 2 shared diseasesPeripheral arterial disease, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Peripheral arterial disease), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Peripheral arterial disease, Psychiatric disorders — evidence mostly GWAS catalog. NXPH1 3 shared diseasesVascular dementia, Gastric cancer, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Gastric cancer), GWAS catalog (Psychiatric disorders), GWAS catalog (Vascular dementia) Related via 3 shared diseases including Vascular dementia, Gastric cancer — evidence mostly GWAS catalog.
Breast cancer Linked via 2 of 5 related genesKLC1, NXPH1 Migraine Linked via 1 of 5 related genesAKAP7 Autism Linked via 1 of 5 related genesKLC1 Gout Linked via 1 of 5 related genesKLC1 Multiple sclerosis Linked via 1 of 5 related genesKLC1