Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9465
Gene name	A-kinase anchoring protein 7
Gene symbol	AKAP7
Synonyms (NCBI Gene)	AKAP15AKAP18
Chromosome	6
Chromosome location	6q23.2
Summary	This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartment

62 Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019848	hsa-miR-375	Microarray	20215506
MIRT024297	hsa-miR-215-5p	Microarray	19074876
MIRT026405	hsa-miR-192-5p	Microarray	19074876
MIRT030508	hsa-miR-24-3p	Microarray	19748357
MIRT041881	hsa-miR-484	CLASH	23622248
MIRT775955	hsa-miR-153	CLIP-seq
MIRT775956	hsa-miR-217	CLIP-seq
MIRT775957	hsa-miR-3117-3p	CLIP-seq
MIRT775958	hsa-miR-548l	CLIP-seq
MIRT775959	hsa-miR-548n	CLIP-seq
MIRT775960	hsa-miR-342-3p	CLIP-seq
MIRT775961	hsa-miR-4740-3p	CLIP-seq
MIRT775962	hsa-miR-539	CLIP-seq
MIRT775958	hsa-miR-548l	CLIP-seq
MIRT775959	hsa-miR-548n	CLIP-seq
MIRT775958	hsa-miR-548l	CLIP-seq
MIRT775959	hsa-miR-548n	CLIP-seq
MIRT1928981	hsa-miR-1267	CLIP-seq
MIRT1928982	hsa-miR-136	CLIP-seq
MIRT1928983	hsa-miR-3182	CLIP-seq
MIRT1928984	hsa-miR-4652-3p	CLIP-seq
MIRT1928985	hsa-miR-4659a-3p	CLIP-seq
MIRT1928986	hsa-miR-4659b-3p	CLIP-seq
MIRT775958	hsa-miR-548l	CLIP-seq
MIRT775959	hsa-miR-548n	CLIP-seq
MIRT775958	hsa-miR-548l	CLIP-seq
MIRT775959	hsa-miR-548n	CLIP-seq
MIRT2472407	hsa-miR-1264	CLIP-seq
MIRT2472408	hsa-miR-2053	CLIP-seq
MIRT2472409	hsa-miR-21	CLIP-seq
MIRT2472410	hsa-miR-218	CLIP-seq
MIRT2472411	hsa-miR-3668	CLIP-seq
MIRT2472412	hsa-miR-382	CLIP-seq
MIRT2472413	hsa-miR-3973	CLIP-seq
MIRT2472414	hsa-miR-452	CLIP-seq
MIRT2472415	hsa-miR-4676-3p	CLIP-seq
MIRT2472416	hsa-miR-4680-3p	CLIP-seq
MIRT2472417	hsa-miR-4693-5p	CLIP-seq
MIRT2472418	hsa-miR-4732-5p	CLIP-seq
MIRT2472419	hsa-miR-520g	CLIP-seq
MIRT2472420	hsa-miR-520h	CLIP-seq
MIRT2472421	hsa-miR-569	CLIP-seq
MIRT2472422	hsa-miR-579	CLIP-seq
MIRT2472423	hsa-miR-590-5p	CLIP-seq
MIRT2472424	hsa-miR-598	CLIP-seq
MIRT2472425	hsa-miR-628-5p	CLIP-seq
MIRT2472409	hsa-miR-21	CLIP-seq
MIRT2472410	hsa-miR-218	CLIP-seq
MIRT2472411	hsa-miR-3668	CLIP-seq
MIRT2472412	hsa-miR-382	CLIP-seq
MIRT2472413	hsa-miR-3973	CLIP-seq
MIRT2472414	hsa-miR-452	CLIP-seq
MIRT2472415	hsa-miR-4676-3p	CLIP-seq
MIRT2472416	hsa-miR-4680-3p	CLIP-seq
MIRT2472417	hsa-miR-4693-5p	CLIP-seq
MIRT2472418	hsa-miR-4732-5p	CLIP-seq
MIRT2472419	hsa-miR-520g	CLIP-seq
MIRT2472420	hsa-miR-520h	CLIP-seq
MIRT2472422	hsa-miR-579	CLIP-seq
MIRT2472423	hsa-miR-590-5p	CLIP-seq
MIRT2472424	hsa-miR-598	CLIP-seq
MIRT2472425	hsa-miR-628-5p	CLIP-seq

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001508	Process	Action potential	IDA	11299204
GO:0005515	Function	Protein binding	IPI	17244820, 25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10613906
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10613906
GO:0006811	Process	Monoatomic ion transport	TAS	9545239
GO:0008104	Process	Intracellular protein localization	IC	9545239
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	10613906
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	10613906
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	25097019
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA
GO:0034237	Function	Protein kinase A regulatory subunit binding	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	10613906
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051018	Function	Protein kinase A binding	IDA	9545239, 10613906
GO:0051018	Function	Protein kinase A binding	IEA
GO:0051018	Function	Protein kinase A binding	IPI	25097019
GO:0051018	Function	Protein kinase A binding	TAS	10613906
GO:0060306	Process	Regulation of membrane repolarization	IDA	11299204
GO:0071320	Process	Cellular response to cAMP	IDA	11299204
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:1901381	Process	Positive regulation of potassium ion transmembrane transport	IDA	11299204

MIM	HGNC	e!Ensembl
604693	377	ENSG00000118507

O43687

Protein name

A-kinase anchor protein 7 isoforms alpha and beta (AKAP-7 isoforms alpha and beta) (A-kinase anchor protein 18 kDa) (AKAP 18) (Protein kinase A-anchoring protein 7 isoforms alpha/beta) (PRKA7 isoforms alpha/beta)

Protein function

Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic f

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10470	AKAP7_RIRII_bdg	45 → 102	PKA-RI-RII subunit binding domain of A-kinase anchor protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, lung, pancreas and skeletal muscle. {ECO:0000269|PubMed:9545239}.

Sequence

MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLV
ENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

Sequence length

104

Q9P0M2

Protein name

A-kinase anchor protein 7 isoform gamma (AKAP-7 isoform gamma) (A-kinase anchor protein 18 kDa) (AKAP 18) (Protein kinase A-anchoring protein 7 isoform gamma) (PRKA7 isoform gamma)

Protein function

Probably targets cAMP-dependent protein kinase (PKA) to the cellular membrane or cytoskeletal structures. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate E

PDB

4ZP3 , 5JJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10469	AKAP7_NLS	85 → 283		Domain
PF10470	AKAP7_RIRII_bdg	289 → 346	PKA-RI-RII subunit binding domain of A-kinase anchor protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, lung, pancreas and placenta. {ECO:0000269|PubMed:10613906}.

Sequence

MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLK
RSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAM
VSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGF
VKLAEGDHVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKID
PDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEKNGGEPDDAELVRLS
KRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

Sequence length

348

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (9)
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	23502783	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	28446746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37123010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28446746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37123010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AKAP7 (A-kinase anchoring protein 7)

Save This Analysis