C1GALT1C1L (C1GALT1 specific chaperone 1 like)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 728819
Gene name C1GALT1 specific chaperone 1 like
Gene symbol C1GALT1C1L
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p21
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0006493 Process Protein O-linked glycosylation IEA
GO:0016020 Component Membrane IEA
GO:0016263 Function Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DN25
Protein name C1GALT1-specific chaperone 1-like protein
Family and domains
Sequence 
MVSASGTSFFKGMLLGSISWVLITMFGQIHIRHRGQTQDHEHHHLRPPNRNDFLNTSKVI
LLELSKSIRVFCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQM
RTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVT
VEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGR
DVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPQKMEVMMYGLYRLRAFGHYF
NDTLVFLPPVGSEND
Sequence length 315
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Mucin type O-glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Sort by:
POC1B-GALNT4 2 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis Related via 2 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT6 2 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis Related via 2 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT5 2 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis Related via 2 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT13 2 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis Related via 2 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis. GALNT15 2 shared pathwaysMucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis Related via 2 shared pathways including Mucin type O-glycan biosynthesis, Other types of O-glycan biosynthesis.
Schizophrenia Linked via 3 of 5 related genesPOC1B-GALNT4, GALNT5, GALNT13 Metabolic syndrome Linked via 2 of 5 related genesPOC1B-GALNT4, GALNT13 Diabetes mellitus type 2 Linked via 2 of 5 related genesPOC1B-GALNT4, GALNT13 Alzheimer disease Linked via 2 of 5 related genesGALNT13, GALNT15 Cone-rod dystrophy Linked via 1 of 5 related genesPOC1B-GALNT4