Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8704
Gene name	Beta-1,4-galactosyltransferase 2
Gene symbol	B4GALT2
Synonyms (NCBI Gene)	B4Gal-T2B4Gal-T3beta4Gal-T2
Chromosome	1
Chromosome location	1p34.1
Summary	This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to si

41 Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050596	hsa-miR-20a-5p	CLASH	23622248
MIRT049075	hsa-miR-92a-3p	CLASH	23622248
MIRT046876	hsa-miR-221-3p	CLASH	23622248
MIRT813820	hsa-miR-1321	CLIP-seq
MIRT813821	hsa-miR-1913	CLIP-seq
MIRT813822	hsa-miR-324-3p	CLIP-seq
MIRT813823	hsa-miR-331-3p	CLIP-seq
MIRT813824	hsa-miR-3679-3p	CLIP-seq
MIRT813825	hsa-miR-378g	CLIP-seq
MIRT813826	hsa-miR-4278	CLIP-seq
MIRT813827	hsa-miR-4283	CLIP-seq
MIRT813828	hsa-miR-4308	CLIP-seq
MIRT813829	hsa-miR-4489	CLIP-seq
MIRT813830	hsa-miR-4492	CLIP-seq
MIRT813831	hsa-miR-4498	CLIP-seq
MIRT813832	hsa-miR-4505	CLIP-seq
MIRT813833	hsa-miR-4533	CLIP-seq
MIRT813834	hsa-miR-4716-3p	CLIP-seq
MIRT813835	hsa-miR-4723-5p	CLIP-seq
MIRT813836	hsa-miR-4728-5p	CLIP-seq
MIRT813837	hsa-miR-4739	CLIP-seq
MIRT813838	hsa-miR-4747-5p	CLIP-seq
MIRT813839	hsa-miR-4756-5p	CLIP-seq
MIRT813840	hsa-miR-499a-5p	CLIP-seq
MIRT813841	hsa-miR-7	CLIP-seq
MIRT813842	hsa-miR-762	CLIP-seq
MIRT1940551	hsa-miR-4738-3p	CLIP-seq
MIRT813823	hsa-miR-331-3p	CLIP-seq
MIRT813824	hsa-miR-3679-3p	CLIP-seq
MIRT813828	hsa-miR-4308	CLIP-seq
MIRT813841	hsa-miR-7	CLIP-seq
MIRT2482939	hsa-miR-3148	CLIP-seq
MIRT2482940	hsa-miR-3606	CLIP-seq
MIRT2482941	hsa-miR-3667-5p	CLIP-seq
MIRT2482942	hsa-miR-3978	CLIP-seq
MIRT2482943	hsa-miR-570	CLIP-seq
MIRT2482939	hsa-miR-3148	CLIP-seq
MIRT2482940	hsa-miR-3606	CLIP-seq
MIRT2482941	hsa-miR-3667-5p	CLIP-seq
MIRT2482942	hsa-miR-3978	CLIP-seq
MIRT2482943	hsa-miR-570	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0003831	Function	Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IEA
GO:0003945	Function	N-acetyllactosamine synthase activity	IEA
GO:0004461	Function	Lactose synthase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0007420	Process	Brain development	IEA
GO:0007613	Process	Memory	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008378	Function	Galactosyltransferase activity	IBA
GO:0008378	Function	Galactosyltransferase activity	TAS	9405390
GO:0008542	Process	Visual learning	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0021680	Process	Cerebellar Purkinje cell layer development	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070085	Process	Glycosylation	IBA

MIM	HGNC	e!Ensembl
604013	925	ENSG00000117411

O60909

Protein name

Beta-1,4-galactosyltransferase 2 (Beta-1,4-GalTase 2) (Beta4Gal-T2) (b4Gal-T2) (EC 2.4.1.-) (Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase) (Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase) (EC 2.4.1.38) (Lactose

Protein function

Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids (PubMed:9405390). Can produce lactose (PubMed:9405390).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02709	Glyco_transf_7C	235 → 312	N-terminal domain of galactosyltransferase	Family
PF13733	Glyco_transf_7N	97 → 231	N-terminal region of glycosyl transferase group 7	Domain

Tissue specificity

TISSUE SPECIFICITY: Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain. {ECO:0000269|PubMed:9405390}.

Sequence

MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASS
SSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLER
VQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYV
INQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIA
MDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
IRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
DIGRPPSWPPRG

Sequence length

372

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Galactose metabolism	Keratan sulfate biosynthesis
N-Glycan biosynthesis	N-Glycan antennae elongation
Various types of N-glycan biosynthesis
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
B4GALT3	[]	8	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Other types of O-glycan biosynthesis","Mannose type O-glycan biosynthesis","Glycosaminoglycan biosynthesis - keratan sulfate","Glycosphingolipid biosynthesis - lacto and neolacto series","Keratan sulfate biosynthesis","N-Glycan antennae elongation"]	[]
B4GALT1	[]	9	["Galactose metabolism","N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Other types of O-glycan biosynthesis","Mannose type O-glycan biosynthesis","Glycosaminoglycan biosynthesis - keratan sulfate","Glycosphingolipid biosynthesis - lacto and neolacto series","Keratan sulfate biosynthesis","N-Glycan antennae elongation"]	[]
ST3GAL3	[]	6	["Various types of N-glycan biosynthesis","Other types of O-glycan biosynthesis","Mannose type O-glycan biosynthesis","Glycosaminoglycan biosynthesis - keratan sulfate","Glycosphingolipid biosynthesis - lacto and neolacto series","Keratan sulfate biosynthesis"]	[]
B4GALT4	[]	4	["Glycosaminoglycan biosynthesis - keratan sulfate","Glycosphingolipid biosynthesis - lacto and neolacto series","Keratan sulfate biosynthesis","N-Glycan antennae elongation"]	[]
MGAT4B	[]	3	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","N-Glycan antennae elongation"]	[]

B4GALT2 (beta-1,4-galactosyltransferase 2)

Bookmark This Gene