ASTN2 (astrotactin 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23245
• Gene name: Astrotactin 2
• Gene symbol: ASTN2
• Synonyms (NCBI Gene): bA67K19.1
• Chromosome: 9
• Chromosome location: 9q33.1
• Summary: This gene encodes a protein that is expressed in the brain and may function in neuronal migration, based on functional studies of the related astrotactin 1 gene in human and mouse. A deletion at this locus has been associated with schizophrenia. Multiple

miRNA Show/Hide all (803)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029089	hsa-miR-26b-5p	Microarray	19088304
MIRT710467	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT710466	hsa-miR-3152-3p	HITS-CLIP	19536157
MIRT710465	hsa-miR-6828-3p	HITS-CLIP	19536157
MIRT710464	hsa-miR-6071	HITS-CLIP	19536157
MIRT710463	hsa-miR-544a	HITS-CLIP	19536157
MIRT710462	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT710461	hsa-miR-2113	HITS-CLIP	19536157
MIRT710460	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT663564	hsa-miR-8485	HITS-CLIP	23824327
MIRT663563	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT663562	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT663561	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT488895	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT488894	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT488893	hsa-miR-4779	PAR-CLIP	20371350
MIRT488891	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569620	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT569619	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT569618	hsa-miR-4784	PAR-CLIP	20371350
MIRT488892	hsa-miR-4419a	PAR-CLIP	20371350
MIRT488890	hsa-miR-4510	PAR-CLIP	20371350
MIRT488889	hsa-miR-6127	PAR-CLIP	20371350
MIRT488888	hsa-miR-6129	PAR-CLIP	20371350
MIRT488887	hsa-miR-6130	PAR-CLIP	20371350
MIRT488886	hsa-miR-6133	PAR-CLIP	20371350
MIRT488884	hsa-miR-6077	PAR-CLIP	20371350
MIRT569617	hsa-miR-4434	PAR-CLIP	20371350
MIRT569616	hsa-miR-4516	PAR-CLIP	20371350
MIRT569615	hsa-miR-5703	PAR-CLIP	20371350
MIRT488883	hsa-miR-765	PAR-CLIP	20371350
MIRT488882	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT488881	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT488880	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT488878	hsa-miR-8085	PAR-CLIP	20371350
MIRT488879	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT488877	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT488895	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT488894	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT488893	hsa-miR-4779	PAR-CLIP	23592263
MIRT488891	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT488892	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488890	hsa-miR-4510	PAR-CLIP	23592263
MIRT488889	hsa-miR-6127	PAR-CLIP	23592263
MIRT488888	hsa-miR-6129	PAR-CLIP	23592263
MIRT488887	hsa-miR-6130	PAR-CLIP	23592263
MIRT488886	hsa-miR-6133	PAR-CLIP	23592263
MIRT488884	hsa-miR-6077	PAR-CLIP	23592263
MIRT488885	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT488883	hsa-miR-765	PAR-CLIP	23592263
MIRT488882	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488881	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488880	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT488878	hsa-miR-8085	PAR-CLIP	23592263
MIRT488879	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT488877	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT446548	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT446547	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT446546	hsa-miR-591	PAR-CLIP	22100165
MIRT446545	hsa-miR-1253	PAR-CLIP	22100165
MIRT446544	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT710467	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT710466	hsa-miR-3152-3p	HITS-CLIP	19536157
MIRT710465	hsa-miR-6828-3p	HITS-CLIP	19536157
MIRT710464	hsa-miR-6071	HITS-CLIP	19536157
MIRT710463	hsa-miR-544a	HITS-CLIP	19536157
MIRT710462	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT710461	hsa-miR-2113	HITS-CLIP	19536157
MIRT710460	hsa-miR-5010-3p	HITS-CLIP	19536157
MIRT663564	hsa-miR-8485	HITS-CLIP	23824327
MIRT663563	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT663562	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT663561	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT488895	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT488894	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT488893	hsa-miR-4779	PAR-CLIP	20371350
MIRT488891	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569620	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT569619	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT569618	hsa-miR-4784	PAR-CLIP	20371350
MIRT488892	hsa-miR-4419a	PAR-CLIP	20371350
MIRT488890	hsa-miR-4510	PAR-CLIP	20371350
MIRT488889	hsa-miR-6127	PAR-CLIP	20371350
MIRT488888	hsa-miR-6129	PAR-CLIP	20371350
MIRT488887	hsa-miR-6130	PAR-CLIP	20371350
MIRT488886	hsa-miR-6133	PAR-CLIP	20371350
MIRT488884	hsa-miR-6077	PAR-CLIP	20371350
MIRT569617	hsa-miR-4434	PAR-CLIP	20371350
MIRT569616	hsa-miR-4516	PAR-CLIP	20371350
MIRT569615	hsa-miR-5703	PAR-CLIP	20371350
MIRT488883	hsa-miR-765	PAR-CLIP	20371350
MIRT488882	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT488881	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT488880	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT488878	hsa-miR-8085	PAR-CLIP	20371350
MIRT488879	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT488877	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT488895	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT488894	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT488893	hsa-miR-4779	PAR-CLIP	23592263
MIRT488891	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT488892	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488890	hsa-miR-4510	PAR-CLIP	23592263
MIRT488889	hsa-miR-6127	PAR-CLIP	23592263
MIRT488888	hsa-miR-6129	PAR-CLIP	23592263
MIRT488887	hsa-miR-6130	PAR-CLIP	23592263
MIRT488886	hsa-miR-6133	PAR-CLIP	23592263
MIRT488884	hsa-miR-6077	PAR-CLIP	23592263
MIRT488885	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT488883	hsa-miR-765	PAR-CLIP	23592263
MIRT488882	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488881	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488880	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT488878	hsa-miR-8085	PAR-CLIP	23592263
MIRT488879	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT488877	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT446548	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT446547	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT446546	hsa-miR-591	PAR-CLIP	22100165
MIRT446545	hsa-miR-1253	PAR-CLIP	22100165
MIRT446544	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT803297	hsa-miR-1197	CLIP-seq
MIRT803298	hsa-miR-1225-5p	CLIP-seq
MIRT803299	hsa-miR-1237	CLIP-seq
MIRT803300	hsa-miR-1246	CLIP-seq
MIRT803301	hsa-miR-1248	CLIP-seq
MIRT803302	hsa-miR-1252	CLIP-seq
MIRT803303	hsa-miR-125a-5p	CLIP-seq
MIRT803304	hsa-miR-125b	CLIP-seq
MIRT803305	hsa-miR-1261	CLIP-seq
MIRT803306	hsa-miR-1263	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803308	hsa-miR-1284	CLIP-seq
MIRT803309	hsa-miR-129-5p	CLIP-seq
MIRT803310	hsa-miR-1302	CLIP-seq
MIRT803311	hsa-miR-1303	CLIP-seq
MIRT803312	hsa-miR-1304	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803315	hsa-miR-1323	CLIP-seq
MIRT803316	hsa-miR-1343	CLIP-seq
MIRT803317	hsa-miR-139-5p	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803322	hsa-miR-15a	CLIP-seq
MIRT803323	hsa-miR-15b	CLIP-seq
MIRT803324	hsa-miR-16	CLIP-seq
MIRT803325	hsa-miR-181a	CLIP-seq
MIRT803326	hsa-miR-181b	CLIP-seq
MIRT803327	hsa-miR-181c	CLIP-seq
MIRT803328	hsa-miR-181d	CLIP-seq
MIRT803329	hsa-miR-182	CLIP-seq
MIRT803330	hsa-miR-186	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803332	hsa-miR-188-5p	CLIP-seq
MIRT803333	hsa-miR-1912	CLIP-seq
MIRT803334	hsa-miR-195	CLIP-seq
MIRT803335	hsa-miR-197	CLIP-seq
MIRT803336	hsa-miR-21	CLIP-seq
MIRT803337	hsa-miR-2116	CLIP-seq
MIRT803338	hsa-miR-216b	CLIP-seq
MIRT803339	hsa-miR-2278	CLIP-seq
MIRT803340	hsa-miR-27a	CLIP-seq
MIRT803341	hsa-miR-27b	CLIP-seq
MIRT803342	hsa-miR-28-5p	CLIP-seq
MIRT803343	hsa-miR-298	CLIP-seq
MIRT803344	hsa-miR-29a	CLIP-seq
MIRT803345	hsa-miR-29b	CLIP-seq
MIRT803346	hsa-miR-29c	CLIP-seq
MIRT803347	hsa-miR-300	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803350	hsa-miR-3065-3p	CLIP-seq
MIRT803351	hsa-miR-3065-5p	CLIP-seq
MIRT803352	hsa-miR-31	CLIP-seq
MIRT803353	hsa-miR-3121-3p	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803355	hsa-miR-3129-3p	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803358	hsa-miR-3134	CLIP-seq
MIRT803359	hsa-miR-3139	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803361	hsa-miR-3159	CLIP-seq
MIRT803362	hsa-miR-3160-3p	CLIP-seq
MIRT803363	hsa-miR-3163	CLIP-seq
MIRT803364	hsa-miR-3185	CLIP-seq
MIRT803365	hsa-miR-3192	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803367	hsa-miR-323-3p	CLIP-seq
MIRT803368	hsa-miR-326	CLIP-seq
MIRT803369	hsa-miR-330-5p	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803371	hsa-miR-338-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803374	hsa-miR-3613-3p	CLIP-seq
MIRT803375	hsa-miR-3646	CLIP-seq
MIRT803376	hsa-miR-365	CLIP-seq
MIRT803377	hsa-miR-3653	CLIP-seq
MIRT803378	hsa-miR-3658	CLIP-seq
MIRT803379	hsa-miR-3662	CLIP-seq
MIRT803380	hsa-miR-3663-3p	CLIP-seq
MIRT803381	hsa-miR-3664-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803384	hsa-miR-3680	CLIP-seq
MIRT803385	hsa-miR-3684	CLIP-seq
MIRT803386	hsa-miR-3688-3p	CLIP-seq
MIRT803387	hsa-miR-3690	CLIP-seq
MIRT803388	hsa-miR-371b-5p	CLIP-seq
MIRT803389	hsa-miR-381	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803391	hsa-miR-3976	CLIP-seq
MIRT803392	hsa-miR-421	CLIP-seq
MIRT803393	hsa-miR-424	CLIP-seq
MIRT803394	hsa-miR-4254	CLIP-seq
MIRT803395	hsa-miR-4257	CLIP-seq
MIRT803396	hsa-miR-4261	CLIP-seq
MIRT803397	hsa-miR-4262	CLIP-seq
MIRT803398	hsa-miR-4268	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803402	hsa-miR-4298	CLIP-seq
MIRT803403	hsa-miR-4302	CLIP-seq
MIRT803404	hsa-miR-4311	CLIP-seq
MIRT803405	hsa-miR-4314	CLIP-seq
MIRT803406	hsa-miR-4319	CLIP-seq
MIRT803407	hsa-miR-4320	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803409	hsa-miR-4422	CLIP-seq
MIRT803410	hsa-miR-4426	CLIP-seq
MIRT803411	hsa-miR-4428	CLIP-seq
MIRT803412	hsa-miR-4432	CLIP-seq
MIRT803413	hsa-miR-4436a	CLIP-seq
MIRT803414	hsa-miR-4448	CLIP-seq
MIRT803415	hsa-miR-4468	CLIP-seq
MIRT803416	hsa-miR-4470	CLIP-seq
MIRT803417	hsa-miR-4487	CLIP-seq
MIRT803418	hsa-miR-4502	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803421	hsa-miR-4519	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803423	hsa-miR-4530	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803425	hsa-miR-4638-3p	CLIP-seq
MIRT803426	hsa-miR-4646-5p	CLIP-seq
MIRT803427	hsa-miR-4647	CLIP-seq
MIRT803428	hsa-miR-4659a-3p	CLIP-seq
MIRT803429	hsa-miR-4659b-3p	CLIP-seq
MIRT803430	hsa-miR-4661-5p	CLIP-seq
MIRT803431	hsa-miR-4662b	CLIP-seq
MIRT803432	hsa-miR-4666-3p	CLIP-seq
MIRT803433	hsa-miR-4677-5p	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803435	hsa-miR-4694-3p	CLIP-seq
MIRT803436	hsa-miR-4696	CLIP-seq
MIRT803437	hsa-miR-4700-3p	CLIP-seq
MIRT803438	hsa-miR-4709-5p	CLIP-seq
MIRT803439	hsa-miR-4712-3p	CLIP-seq
MIRT803440	hsa-miR-4724-5p	CLIP-seq
MIRT803441	hsa-miR-4732-3p	CLIP-seq
MIRT803442	hsa-miR-4732-5p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT803444	hsa-miR-4747-5p	CLIP-seq
MIRT803445	hsa-miR-4762-5p	CLIP-seq
MIRT803446	hsa-miR-4766-5p	CLIP-seq
MIRT803447	hsa-miR-4768-3p	CLIP-seq
MIRT803448	hsa-miR-4789-3p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803450	hsa-miR-4793-5p	CLIP-seq
MIRT803451	hsa-miR-4802-3p	CLIP-seq
MIRT803452	hsa-miR-483-3p	CLIP-seq
MIRT803453	hsa-miR-495	CLIP-seq
MIRT803454	hsa-miR-497	CLIP-seq
MIRT803455	hsa-miR-501-3p	CLIP-seq
MIRT803456	hsa-miR-502-3p	CLIP-seq
MIRT803457	hsa-miR-505	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803460	hsa-miR-513a-5p	CLIP-seq
MIRT803461	hsa-miR-520d-5p	CLIP-seq
MIRT803462	hsa-miR-524-5p	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT803464	hsa-miR-545	CLIP-seq
MIRT803465	hsa-miR-548c-3p	CLIP-seq
MIRT803466	hsa-miR-548g	CLIP-seq
MIRT803467	hsa-miR-548o	CLIP-seq
MIRT803468	hsa-miR-556-5p	CLIP-seq
MIRT803469	hsa-miR-558	CLIP-seq
MIRT803470	hsa-miR-577	CLIP-seq
MIRT803471	hsa-miR-583	CLIP-seq
MIRT803472	hsa-miR-590-3p	CLIP-seq
MIRT803473	hsa-miR-590-5p	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803476	hsa-miR-610	CLIP-seq
MIRT803477	hsa-miR-621	CLIP-seq
MIRT803478	hsa-miR-642b	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803480	hsa-miR-670	CLIP-seq
MIRT803481	hsa-miR-708	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803483	hsa-miR-888	CLIP-seq
MIRT803484	hsa-miR-942	CLIP-seq
MIRT803298	hsa-miR-1225-5p	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803398	hsa-miR-4268	CLIP-seq
MIRT803414	hsa-miR-4448	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803478	hsa-miR-642b	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803298	hsa-miR-1225-5p	CLIP-seq
MIRT803299	hsa-miR-1237	CLIP-seq
MIRT803300	hsa-miR-1246	CLIP-seq
MIRT803301	hsa-miR-1248	CLIP-seq
MIRT803303	hsa-miR-125a-5p	CLIP-seq
MIRT803304	hsa-miR-125b	CLIP-seq
MIRT803306	hsa-miR-1263	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803310	hsa-miR-1302	CLIP-seq
MIRT803311	hsa-miR-1303	CLIP-seq
MIRT803312	hsa-miR-1304	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803315	hsa-miR-1323	CLIP-seq
MIRT803317	hsa-miR-139-5p	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803322	hsa-miR-15a	CLIP-seq
MIRT803323	hsa-miR-15b	CLIP-seq
MIRT803324	hsa-miR-16	CLIP-seq
MIRT803325	hsa-miR-181a	CLIP-seq
MIRT803326	hsa-miR-181b	CLIP-seq
MIRT803327	hsa-miR-181c	CLIP-seq
MIRT803328	hsa-miR-181d	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803333	hsa-miR-1912	CLIP-seq
MIRT803334	hsa-miR-195	CLIP-seq
MIRT803335	hsa-miR-197	CLIP-seq
MIRT803338	hsa-miR-216b	CLIP-seq
MIRT803340	hsa-miR-27a	CLIP-seq
MIRT803341	hsa-miR-27b	CLIP-seq
MIRT803342	hsa-miR-28-5p	CLIP-seq
MIRT803343	hsa-miR-298	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803351	hsa-miR-3065-5p	CLIP-seq
MIRT803352	hsa-miR-31	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803358	hsa-miR-3134	CLIP-seq
MIRT803359	hsa-miR-3139	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803361	hsa-miR-3159	CLIP-seq
MIRT803362	hsa-miR-3160-3p	CLIP-seq
MIRT803364	hsa-miR-3185	CLIP-seq
MIRT803365	hsa-miR-3192	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803368	hsa-miR-326	CLIP-seq
MIRT803369	hsa-miR-330-5p	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803371	hsa-miR-338-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803374	hsa-miR-3613-3p	CLIP-seq
MIRT803376	hsa-miR-365	CLIP-seq
MIRT803377	hsa-miR-3653	CLIP-seq
MIRT803378	hsa-miR-3658	CLIP-seq
MIRT803379	hsa-miR-3662	CLIP-seq
MIRT803380	hsa-miR-3663-3p	CLIP-seq
MIRT803381	hsa-miR-3664-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803384	hsa-miR-3680	CLIP-seq
MIRT803385	hsa-miR-3684	CLIP-seq
MIRT803386	hsa-miR-3688-3p	CLIP-seq
MIRT803388	hsa-miR-371b-5p	CLIP-seq
MIRT1937245	hsa-miR-377	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803392	hsa-miR-421	CLIP-seq
MIRT803393	hsa-miR-424	CLIP-seq
MIRT803395	hsa-miR-4257	CLIP-seq
MIRT803396	hsa-miR-4261	CLIP-seq
MIRT803397	hsa-miR-4262	CLIP-seq
MIRT803398	hsa-miR-4268	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803402	hsa-miR-4298	CLIP-seq
MIRT803403	hsa-miR-4302	CLIP-seq
MIRT803404	hsa-miR-4311	CLIP-seq
MIRT803405	hsa-miR-4314	CLIP-seq
MIRT803406	hsa-miR-4319	CLIP-seq
MIRT803407	hsa-miR-4320	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803409	hsa-miR-4422	CLIP-seq
MIRT803414	hsa-miR-4448	CLIP-seq
MIRT803416	hsa-miR-4470	CLIP-seq
MIRT803417	hsa-miR-4487	CLIP-seq
MIRT1937246	hsa-miR-4495	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803421	hsa-miR-4519	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803423	hsa-miR-4530	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803426	hsa-miR-4646-5p	CLIP-seq
MIRT803428	hsa-miR-4659a-3p	CLIP-seq
MIRT803429	hsa-miR-4659b-3p	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803438	hsa-miR-4709-5p	CLIP-seq
MIRT803440	hsa-miR-4724-5p	CLIP-seq
MIRT803441	hsa-miR-4732-3p	CLIP-seq
MIRT803442	hsa-miR-4732-5p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT803444	hsa-miR-4747-5p	CLIP-seq
MIRT803445	hsa-miR-4762-5p	CLIP-seq
MIRT803446	hsa-miR-4766-5p	CLIP-seq
MIRT803447	hsa-miR-4768-3p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803450	hsa-miR-4793-5p	CLIP-seq
MIRT803451	hsa-miR-4802-3p	CLIP-seq
MIRT803452	hsa-miR-483-3p	CLIP-seq
MIRT803454	hsa-miR-497	CLIP-seq
MIRT803455	hsa-miR-501-3p	CLIP-seq
MIRT803456	hsa-miR-502-3p	CLIP-seq
MIRT803457	hsa-miR-505	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803460	hsa-miR-513a-5p	CLIP-seq
MIRT803461	hsa-miR-520d-5p	CLIP-seq
MIRT803462	hsa-miR-524-5p	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT803464	hsa-miR-545	CLIP-seq
MIRT803465	hsa-miR-548c-3p	CLIP-seq
MIRT803466	hsa-miR-548g	CLIP-seq
MIRT803467	hsa-miR-548o	CLIP-seq
MIRT803468	hsa-miR-556-5p	CLIP-seq
MIRT803469	hsa-miR-558	CLIP-seq
MIRT803472	hsa-miR-590-3p	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803477	hsa-miR-621	CLIP-seq
MIRT1937247	hsa-miR-633	CLIP-seq
MIRT803478	hsa-miR-642b	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803480	hsa-miR-670	CLIP-seq
MIRT803481	hsa-miR-708	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803483	hsa-miR-888	CLIP-seq
MIRT803484	hsa-miR-942	CLIP-seq
MIRT2176907	hsa-miR-579	CLIP-seq
MIRT2176908	hsa-miR-664	CLIP-seq
MIRT803316	hsa-miR-1343	CLIP-seq
MIRT2176909	hsa-miR-3667-3p	CLIP-seq
MIRT2176910	hsa-miR-3907	CLIP-seq
MIRT2176911	hsa-miR-548q	CLIP-seq
MIRT803298	hsa-miR-1225-5p	CLIP-seq
MIRT803299	hsa-miR-1237	CLIP-seq
MIRT803300	hsa-miR-1246	CLIP-seq
MIRT803301	hsa-miR-1248	CLIP-seq
MIRT803303	hsa-miR-125a-5p	CLIP-seq
MIRT803304	hsa-miR-125b	CLIP-seq
MIRT803306	hsa-miR-1263	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803310	hsa-miR-1302	CLIP-seq
MIRT803311	hsa-miR-1303	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803315	hsa-miR-1323	CLIP-seq
MIRT803317	hsa-miR-139-5p	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803322	hsa-miR-15a	CLIP-seq
MIRT803323	hsa-miR-15b	CLIP-seq
MIRT803324	hsa-miR-16	CLIP-seq
MIRT803325	hsa-miR-181a	CLIP-seq
MIRT803326	hsa-miR-181b	CLIP-seq
MIRT803327	hsa-miR-181c	CLIP-seq
MIRT803328	hsa-miR-181d	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803333	hsa-miR-1912	CLIP-seq
MIRT803334	hsa-miR-195	CLIP-seq
MIRT803335	hsa-miR-197	CLIP-seq
MIRT803336	hsa-miR-21	CLIP-seq
MIRT803338	hsa-miR-216b	CLIP-seq
MIRT803339	hsa-miR-2278	CLIP-seq
MIRT803340	hsa-miR-27a	CLIP-seq
MIRT803341	hsa-miR-27b	CLIP-seq
MIRT803342	hsa-miR-28-5p	CLIP-seq
MIRT803344	hsa-miR-29a	CLIP-seq
MIRT803345	hsa-miR-29b	CLIP-seq
MIRT803346	hsa-miR-29c	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803350	hsa-miR-3065-3p	CLIP-seq
MIRT803351	hsa-miR-3065-5p	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803355	hsa-miR-3129-3p	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803358	hsa-miR-3134	CLIP-seq
MIRT803359	hsa-miR-3139	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803361	hsa-miR-3159	CLIP-seq
MIRT803362	hsa-miR-3160-3p	CLIP-seq
MIRT803365	hsa-miR-3192	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803368	hsa-miR-326	CLIP-seq
MIRT803369	hsa-miR-330-5p	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803371	hsa-miR-338-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803374	hsa-miR-3613-3p	CLIP-seq
MIRT803377	hsa-miR-3653	CLIP-seq
MIRT803378	hsa-miR-3658	CLIP-seq
MIRT803380	hsa-miR-3663-3p	CLIP-seq
MIRT803381	hsa-miR-3664-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803384	hsa-miR-3680	CLIP-seq
MIRT803386	hsa-miR-3688-3p	CLIP-seq
MIRT803388	hsa-miR-371b-5p	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803392	hsa-miR-421	CLIP-seq
MIRT803393	hsa-miR-424	CLIP-seq
MIRT803395	hsa-miR-4257	CLIP-seq
MIRT803396	hsa-miR-4261	CLIP-seq
MIRT803397	hsa-miR-4262	CLIP-seq
MIRT803398	hsa-miR-4268	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803402	hsa-miR-4298	CLIP-seq
MIRT803403	hsa-miR-4302	CLIP-seq
MIRT803404	hsa-miR-4311	CLIP-seq
MIRT803405	hsa-miR-4314	CLIP-seq
MIRT803406	hsa-miR-4319	CLIP-seq
MIRT803407	hsa-miR-4320	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803409	hsa-miR-4422	CLIP-seq
MIRT803410	hsa-miR-4426	CLIP-seq
MIRT803414	hsa-miR-4448	CLIP-seq
MIRT803415	hsa-miR-4468	CLIP-seq
MIRT803417	hsa-miR-4487	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803421	hsa-miR-4519	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803423	hsa-miR-4530	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803426	hsa-miR-4646-5p	CLIP-seq
MIRT803427	hsa-miR-4647	CLIP-seq
MIRT803428	hsa-miR-4659a-3p	CLIP-seq
MIRT803429	hsa-miR-4659b-3p	CLIP-seq
MIRT803431	hsa-miR-4662b	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803438	hsa-miR-4709-5p	CLIP-seq
MIRT803439	hsa-miR-4712-3p	CLIP-seq
MIRT803441	hsa-miR-4732-3p	CLIP-seq
MIRT803442	hsa-miR-4732-5p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT2384537	hsa-miR-4760-3p	CLIP-seq
MIRT803446	hsa-miR-4766-5p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803450	hsa-miR-4793-5p	CLIP-seq
MIRT803451	hsa-miR-4802-3p	CLIP-seq
MIRT803454	hsa-miR-497	CLIP-seq
MIRT803455	hsa-miR-501-3p	CLIP-seq
MIRT803456	hsa-miR-502-3p	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803460	hsa-miR-513a-5p	CLIP-seq
MIRT803461	hsa-miR-520d-5p	CLIP-seq
MIRT803462	hsa-miR-524-5p	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT803467	hsa-miR-548o	CLIP-seq
MIRT803468	hsa-miR-556-5p	CLIP-seq
MIRT803469	hsa-miR-558	CLIP-seq
MIRT2176907	hsa-miR-579	CLIP-seq
MIRT803473	hsa-miR-590-5p	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803478	hsa-miR-642b	CLIP-seq
MIRT2176908	hsa-miR-664	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803480	hsa-miR-670	CLIP-seq
MIRT803481	hsa-miR-708	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803483	hsa-miR-888	CLIP-seq
MIRT803484	hsa-miR-942	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803303	hsa-miR-125a-5p	CLIP-seq
MIRT803304	hsa-miR-125b	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803311	hsa-miR-1303	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803315	hsa-miR-1323	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803322	hsa-miR-15a	CLIP-seq
MIRT803323	hsa-miR-15b	CLIP-seq
MIRT803324	hsa-miR-16	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803332	hsa-miR-188-5p	CLIP-seq
MIRT803334	hsa-miR-195	CLIP-seq
MIRT803335	hsa-miR-197	CLIP-seq
MIRT803336	hsa-miR-21	CLIP-seq
MIRT803342	hsa-miR-28-5p	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803351	hsa-miR-3065-5p	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803359	hsa-miR-3139	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803361	hsa-miR-3159	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803371	hsa-miR-338-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803374	hsa-miR-3613-3p	CLIP-seq
MIRT803381	hsa-miR-3664-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803385	hsa-miR-3684	CLIP-seq
MIRT803386	hsa-miR-3688-3p	CLIP-seq
MIRT803388	hsa-miR-371b-5p	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803393	hsa-miR-424	CLIP-seq
MIRT803395	hsa-miR-4257	CLIP-seq
MIRT803396	hsa-miR-4261	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803404	hsa-miR-4311	CLIP-seq
MIRT803406	hsa-miR-4319	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803416	hsa-miR-4470	CLIP-seq
MIRT803417	hsa-miR-4487	CLIP-seq
MIRT803418	hsa-miR-4502	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803423	hsa-miR-4530	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803440	hsa-miR-4724-5p	CLIP-seq
MIRT803441	hsa-miR-4732-3p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT803445	hsa-miR-4762-5p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803451	hsa-miR-4802-3p	CLIP-seq
MIRT803454	hsa-miR-497	CLIP-seq
MIRT803457	hsa-miR-505	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803461	hsa-miR-520d-5p	CLIP-seq
MIRT803462	hsa-miR-524-5p	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT2444138	hsa-miR-548ac	CLIP-seq
MIRT803465	hsa-miR-548c-3p	CLIP-seq
MIRT2444139	hsa-miR-548d-3p	CLIP-seq
MIRT803467	hsa-miR-548o	CLIP-seq
MIRT2444140	hsa-miR-548z	CLIP-seq
MIRT803471	hsa-miR-583	CLIP-seq
MIRT803472	hsa-miR-590-3p	CLIP-seq
MIRT803473	hsa-miR-590-5p	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803480	hsa-miR-670	CLIP-seq
MIRT803481	hsa-miR-708	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803483	hsa-miR-888	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803322	hsa-miR-15a	CLIP-seq
MIRT803323	hsa-miR-15b	CLIP-seq
MIRT803324	hsa-miR-16	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803334	hsa-miR-195	CLIP-seq
MIRT803336	hsa-miR-21	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803351	hsa-miR-3065-5p	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803356	hsa-miR-3130-3p	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803361	hsa-miR-3159	CLIP-seq
MIRT803366	hsa-miR-3194-3p	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803371	hsa-miR-338-3p	CLIP-seq
MIRT803372	hsa-miR-3545-3p	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803374	hsa-miR-3613-3p	CLIP-seq
MIRT803381	hsa-miR-3664-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803385	hsa-miR-3684	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803393	hsa-miR-424	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803404	hsa-miR-4311	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803416	hsa-miR-4470	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803423	hsa-miR-4530	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803434	hsa-miR-4680-5p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT803445	hsa-miR-4762-5p	CLIP-seq
MIRT803449	hsa-miR-4793-3p	CLIP-seq
MIRT803454	hsa-miR-497	CLIP-seq
MIRT803457	hsa-miR-505	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803459	hsa-miR-512-5p	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT803471	hsa-miR-583	CLIP-seq
MIRT803472	hsa-miR-590-3p	CLIP-seq
MIRT803473	hsa-miR-590-5p	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803479	hsa-miR-665	CLIP-seq
MIRT803482	hsa-miR-767-5p	CLIP-seq
MIRT803303	hsa-miR-125a-5p	CLIP-seq
MIRT803304	hsa-miR-125b	CLIP-seq
MIRT803307	hsa-miR-128	CLIP-seq
MIRT803313	hsa-miR-130a	CLIP-seq
MIRT803314	hsa-miR-130b	CLIP-seq
MIRT803318	hsa-miR-148a	CLIP-seq
MIRT803319	hsa-miR-148b	CLIP-seq
MIRT803320	hsa-miR-151-3p	CLIP-seq
MIRT803321	hsa-miR-152	CLIP-seq
MIRT803331	hsa-miR-188-3p	CLIP-seq
MIRT803348	hsa-miR-301a	CLIP-seq
MIRT803349	hsa-miR-301b	CLIP-seq
MIRT803354	hsa-miR-3123	CLIP-seq
MIRT803357	hsa-miR-3133	CLIP-seq
MIRT803360	hsa-miR-3140-5p	CLIP-seq
MIRT803364	hsa-miR-3185	CLIP-seq
MIRT803370	hsa-miR-335	CLIP-seq
MIRT803373	hsa-miR-3591-3p	CLIP-seq
MIRT803382	hsa-miR-3666	CLIP-seq
MIRT803383	hsa-miR-3671	CLIP-seq
MIRT803390	hsa-miR-3925-5p	CLIP-seq
MIRT803399	hsa-miR-4272	CLIP-seq
MIRT803400	hsa-miR-4286	CLIP-seq
MIRT803401	hsa-miR-4295	CLIP-seq
MIRT803406	hsa-miR-4319	CLIP-seq
MIRT803408	hsa-miR-4330	CLIP-seq
MIRT803409	hsa-miR-4422	CLIP-seq
MIRT2480292	hsa-miR-4427	CLIP-seq
MIRT803419	hsa-miR-4506	CLIP-seq
MIRT803420	hsa-miR-4511	CLIP-seq
MIRT803422	hsa-miR-451b	CLIP-seq
MIRT803424	hsa-miR-454	CLIP-seq
MIRT803441	hsa-miR-4732-3p	CLIP-seq
MIRT803443	hsa-miR-4738-3p	CLIP-seq
MIRT2384537	hsa-miR-4760-3p	CLIP-seq
MIRT803445	hsa-miR-4762-5p	CLIP-seq
MIRT803457	hsa-miR-505	CLIP-seq
MIRT803458	hsa-miR-510	CLIP-seq
MIRT803463	hsa-miR-532-3p	CLIP-seq
MIRT803471	hsa-miR-583	CLIP-seq
MIRT803474	hsa-miR-593	CLIP-seq
MIRT803475	hsa-miR-607	CLIP-seq
MIRT803480	hsa-miR-670	CLIP-seq
MIRT803316	hsa-miR-1343	CLIP-seq
MIRT2176909	hsa-miR-3667-3p	CLIP-seq
MIRT2675544	hsa-miR-516a-3p	CLIP-seq
MIRT2176911	hsa-miR-548q	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0005509	Function	Calcium ion binding	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007158	Process	Neuron cell-cell adhesion	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034394	Process	Protein localization to cell surface	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	IBA
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	IDA
GO:0046872	Function	Metal ion binding	IEA
GO:0048105	Process	Establishment of body hair planar orientation	IEA
GO:0060187	Component	Cell pole	IEA
GO:2000009	Process	Negative regulation of protein localization to cell surface	IEA

Other IDs

• MIM: 612856
• HGNC: 17021
• e!Ensembl: ENSG00000148219

Protein

• UniProt ID: O75129
• Protein name: Astrotactin-2
• Protein function: Mediates recycling of the neuronal cell adhesion molecule ASTN1 to the anterior pole of the cell membrane in migrating neurons. Promotes ASTN1 internalization and intracellular transport of endocytosed ASTN1 (By similarity). Selectively binds in
• PDB: 5J67 , 5J68 , 5J69
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01823	MACPF	853 → 967	MAC/Perforin domain	Domain
  PF14670	FXa_inhibition	703 → 750		Domain
  PF18411	Annexin_like	1190 → 1282	Annexin-like domain	Domain
  PF18577	ASTN_2_hairpin	1286 → 1332	Astrotactin-2 C-terminal beta-hairpin domain	Domain

• Sequence:

  MAAAGARLSPGPGSGLRGRPRLCFHPGPPPLLPLLLLFLLLLPPPPLLAGATAAASREPD
  SPCRLKTVTVSTLPALRESDIGWSGARAGAGAGTGAGAAAAAASPGSPGSAGTAAESRLL
  LFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSS
  GQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRRRIP
  QKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDCEEDEE
  PPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKAAAEATQETVESLMQKFKESFR
  ANTPIEIGQLQPPLRSTSAGKRKRRSKSRGGISFGRAKGTSGSEADDETQLTFYTEQYRS
  RRRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVV
  SEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCHEGYA
  PDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKS
  FVVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNG
  GCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTL
  PLPYDATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHG
  YNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLT
  GDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHY
  GSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLT
  AQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDN
  GTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSS
  TVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAG
  RSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEE
  IADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGP
  RKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKIT
  CEEKMVSMARNTYGESKGR

• Sequence length: 1339

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (60)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	18316681	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTN2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	36653681	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	18839057, 32279069	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	19404257	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME 11	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	31043756, 31926635	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	31043756	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683, 32139696, 32887889, 34290314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683, 32139696, 32887889, 34290314, 35803233	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	30804561, 37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	36077729	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON MIGRAINE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35915156	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	36914876, 40262193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	35803233	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	34847940	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	28000841	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet, GenCC Disgenet, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMB-GIRDLE MUSCULAR DYSTROPHY AUTOSOMAL RECESSIVE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMB-GIRDLE MUSCULAR DYSTROPHY TYPE 2H	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29700475, 29942085, 30718901, 31926635, 33479212, 34586374, 34924174, 35026594, 37464041, 38177345	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	22683712, 23793025, 27182965, 27322543, 32632093, 34294844, 35115687, 36939796, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITHOUT AURA	—	CTD	22683712	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	29942085	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29942085	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	30374069, 30664745, 34450027, 40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD, GWAS catalog CTD, GWAS catalog	30374069, 30664745, 34450027, 36376028, 40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	28470677	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROTATOR CUFF TEAR	—	GWAS catalog	33482370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcotubular myopathy	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	23509962	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (58)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anhedonia	Anhedonia	Pubtator	34440368	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	24381304	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24381304	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	18839057		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	18839057		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20889312, 21832240, 27138430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	24381304, 30392976	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19404257, 21832240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19404257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19404257	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	CLINVAR_DG	11822024, 15786463, 21775502, 23142638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARDET-BIEDL SYNDROME 11	Bardet-Biedl Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20889312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	35667888	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	21685187, 30804561		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22504421, 25351777	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25410587		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	CTD_human_DG	22683712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	GWASDB_DG	23793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	GWASCAT_DG	27322543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	BEFREE	28058730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	BEFREE	22504421		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22504421	Associate	★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24381304	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25083881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	25083881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	23585864	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22504421, 25351777		★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	24381304	Associate	★☆☆☆☆ Found in Text Mining only
Limb-girdle muscular dystrophy type 2H	Sarcotubular myopathy	CLINVAR_DG	11822024, 15786463, 21775502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	26635082	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29700475, 30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29803967		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34440368	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	GWASDB_DG	22683712, 23793025		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	22683712, 23793025, 27182965, 27322543		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	24674449, 39333847	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28058730		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	34440368	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24381304		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34440368	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	33055079	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	25939412	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30374069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30374069, 30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	28470677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Presenile dementia	Senile Dementia	BEFREE	22504421		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	25313508	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35308900	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18940311, 20889312, 25410587, 29803967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18940311, 20889312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29803967	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	GWASCAT_DG	30738427		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TRIM32 3 shared diseasesLimb girdle muscular dystrophy, Bardet-biedl syndrome, Myopathy 3 shared evidence sourcesDisgenet (Limb girdle muscular dystrophy), Disgenet (Bardet-biedl syndrome), Disgenet (Myopathy) Related via 3 shared diseases including Limb girdle muscular dystrophy, Bardet-biedl syndrome — evidence mostly Disgenet. MAP2K5 2 shared diseasesAmphetamine or sympathomimetic abuse, Willis-ekbom disease 4 shared evidence sourcesDisgenet (Amphetamine or sympathomimetic abuse), CTD (Amphetamine or sympathomimetic abuse), GWAS catalog (Endometriosis), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Amphetamine or sympathomimetic abuse, Willis-ekbom disease — evidence mostly GWAS catalog. NEGR1 2 shared diseasesMood disorder, Willis-ekbom disease 3 shared evidence sourcesGWAS catalog (Endometriosis), GWAS catalog (Mood disorder), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Mood disorder, Willis-ekbom disease — evidence mostly GWAS catalog. XKR5 2 shared diseasesColonic neoplasms, Hemorrhoid 2 shared evidence sourcesGWAS catalog (Colonic neoplasms), GWAS catalog (Hemorrhoid) Related via 2 shared diseases including Colonic neoplasms, Hemorrhoid — evidence mostly GWAS catalog. ARHGAP27 2 shared diseasesMood disorder, Pancreatic cancer 2 shared evidence sourcesGWAS catalog (Pancreatic cancer), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Pancreatic cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TRIM32	3	["Limb girdle muscular dystrophy","Bardet-biedl syndrome","Myopathy"]	0	[]	3	["Disgenet (Limb girdle muscular dystrophy)","Disgenet (Bardet-biedl syndrome)","Disgenet (Myopathy)"]
MAP2K5	2	["Amphetamine or sympathomimetic abuse","Willis-ekbom disease"]	0	[]	4	["Disgenet (Amphetamine or sympathomimetic abuse)","CTD (Amphetamine or sympathomimetic abuse)","GWAS catalog (Endometriosis)","GWAS catalog (Willis-ekbom disease)"]
NEGR1	2	["Mood disorder","Willis-ekbom disease"]	0	[]	3	["GWAS catalog (Endometriosis)","GWAS catalog (Mood disorder)","GWAS catalog (Willis-ekbom disease)"]
XKR5	2	["Colonic neoplasms","Hemorrhoid"]	0	[]	2	["GWAS catalog (Colonic neoplasms)","GWAS catalog (Hemorrhoid)"]
ARHGAP27	2	["Mood disorder","Pancreatic cancer"]	0	[]	2	["GWAS catalog (Pancreatic cancer)","GWAS catalog (Mood disorder)"]

Diseases Linked via Similar Genes

Colorectal cancer Linked via 3 of 5 related genesMAP2K5, NEGR1, XKR5 Alzheimer disease Linked via 2 of 5 related genesMAP2K5, NEGR1 Colorectal adenoma Linked via 2 of 5 related genesMAP2K5, XKR5 Systemic lupus erythematosus Linked via 2 of 5 related genesNEGR1, ARHGAP27 Muscular dystrophy Linked via 1 of 5 related genesTRIM32

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Colorectal cancer	3	["MAP2K5","NEGR1","XKR5"]
Alzheimer disease	2	["MAP2K5","NEGR1"]
Colorectal adenoma	2	["MAP2K5","XKR5"]
Systemic lupus erythematosus	2	["NEGR1","ARHGAP27"]
Muscular dystrophy	1	["TRIM32"]