Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	398
Gene name	Rho GDP dissociation inhibitor gamma
Gene symbol	ARHGDIG
Synonyms (NCBI Gene)	RHOGDI-3
Chromosome	16
Chromosome location	16p13.3
Summary	The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).[supplied by OMIM, Nov 2010]

35 Show/Hide all (35)

miRTarBase ID	miRNA	Experiments
MIRT795200	hsa-miR-1266	CLIP-seq
MIRT795201	hsa-miR-1909	CLIP-seq
MIRT795202	hsa-miR-1972	CLIP-seq
MIRT795203	hsa-miR-214	CLIP-seq
MIRT795204	hsa-miR-2277-3p	CLIP-seq
MIRT795205	hsa-miR-2278	CLIP-seq
MIRT795206	hsa-miR-342-5p	CLIP-seq
MIRT795207	hsa-miR-3619-5p	CLIP-seq
MIRT795208	hsa-miR-4281	CLIP-seq
MIRT795209	hsa-miR-4449	CLIP-seq
MIRT795210	hsa-miR-4450	CLIP-seq
MIRT795211	hsa-miR-4518	CLIP-seq
MIRT795212	hsa-miR-4532	CLIP-seq
MIRT795213	hsa-miR-4664-5p	CLIP-seq
MIRT795214	hsa-miR-4667-5p	CLIP-seq
MIRT795215	hsa-miR-4688	CLIP-seq
MIRT795216	hsa-miR-4700-5p	CLIP-seq
MIRT795217	hsa-miR-4731-5p	CLIP-seq
MIRT795218	hsa-miR-4755-3p	CLIP-seq
MIRT795219	hsa-miR-4798-3p	CLIP-seq
MIRT795220	hsa-miR-486-3p	CLIP-seq
MIRT795221	hsa-miR-615-5p	CLIP-seq
MIRT795222	hsa-miR-761	CLIP-seq
MIRT795206	hsa-miR-342-5p	CLIP-seq
MIRT795210	hsa-miR-4450	CLIP-seq
MIRT795213	hsa-miR-4664-5p	CLIP-seq
MIRT795214	hsa-miR-4667-5p	CLIP-seq
MIRT795216	hsa-miR-4700-5p	CLIP-seq
MIRT795217	hsa-miR-4731-5p	CLIP-seq
MIRT795201	hsa-miR-1909	CLIP-seq
MIRT795203	hsa-miR-214	CLIP-seq
MIRT795207	hsa-miR-3619-5p	CLIP-seq
MIRT795215	hsa-miR-4688	CLIP-seq
MIRT795220	hsa-miR-486-3p	CLIP-seq
MIRT795222	hsa-miR-761	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001835	Process	Blastocyst hatching	IEA
GO:0005092	Function	GDP-dissociation inhibitor activity	IEA
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	IBA
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	IEA
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	TAS	9113980
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0007162	Process	Negative regulation of cell adhesion	TAS	9113980
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	TAS	9113980
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	TAS	9113980
GO:0032880	Process	Regulation of protein localization	IEA

MIM	HGNC	e!Ensembl
602844	680	ENSG00000242173

Q99819

Protein name

Rho GDP-dissociation inhibitor 3 (Rho GDI 3) (Rho-GDI gamma)

Protein function

Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the re

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02115	Rho_GDI	35 → 222	RHO protein GDP dissociation inhibitor	Domain

Tissue specificity

TISSUE SPECIFICITY: Primarily expressed in pancreas and brain.

Sequence

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIR
QLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD
QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFV
TPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD

Sequence length

225

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Neurotrophin signaling pathway	Rho GTPase cycle
Vasopressin-regulated water reabsorption

ARHGDIG (Rho GDP dissociation inhibitor gamma)

Bookmark This Gene