APOBEC3G (apolipoprotein B mRNA editing enzyme catalytic subunit 3G)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 60489
• Gene name: Apolipoprotein B mRNA editing enzyme catalytic subunit 3G
• Gene symbol: APOBEC3G
• Synonyms (NCBI Gene): A3G, ARCD, ARP-9, ARP9, CEM-15, CEM15, MDS019, bK150C2.7, dJ494G10.1
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736403	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT789970	hsa-miR-203	CLIP-seq
MIRT789971	hsa-miR-4635	CLIP-seq
MIRT789972	hsa-miR-513a-3p	CLIP-seq
MIRT789973	hsa-miR-526b	CLIP-seq

Gene ontology (GO) Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IBA
GO:0000932	Component	P-body	IDA	16699599, 22915799
GO:0000932	Component	P-body	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	17121840
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	11863358
GO:0003824	Function	Catalytic activity	IEA
GO:0004126	Function	Cytidine deaminase activity	IBA
GO:0004126	Function	Cytidine deaminase activity	IDA	12808465, 16378963, 25542899
GO:0004126	Function	Cytidine deaminase activity	TAS	17121840
GO:0005515	Function	Protein binding	IPI	14528301, 15152192, 16699599, 18836454, 19887642, 22915799
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16527742, 16699599, 21835787
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	IDA	11863358
GO:0008270	Function	Zinc ion binding	IEA
GO:0008829	Function	DCTP deaminase activity	TAS
GO:0010526	Process	Transposable element silencing	IDA	16527742
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016553	Process	Base conversion or substitution editing	TAS	17121840
GO:0016554	Process	Cytidine to uridine editing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030895	Component	Apolipoprotein B mRNA editing enzyme complex	TAS	17121840
GO:0042802	Function	Identical protein binding	IPI	11863358, 15152192, 20152150
GO:0045071	Process	Negative regulation of viral genome replication	IDA	17121840
GO:0045087	Process	Innate immune response	IDA	17121840, 22915799
GO:0045087	Process	Innate immune response	IEA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	16571802, 17121840, 21835787, 25542899
GO:0046872	Function	Metal ion binding	IEA
GO:0048525	Process	Negative regulation of viral process	IDA	17121840
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IDA	12808465, 21835787, 22915799, 25542899
GO:0051607	Process	Defense response to virus	IEA
GO:0070383	Process	DNA cytosine deamination	IBA
GO:0070383	Process	DNA cytosine deamination	IDA	16571802, 21835787
GO:0140374	Process	Antiviral innate immune response	IDA	16378963
GO:0140546	Process	Defense response to symbiont	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	16699599

Other IDs

• MIM: 607113
• HGNC: 17357
• e!Ensembl: ENSG00000239713

Protein

• UniProt ID: Q9HC16
• Protein name: DNA dC->dU-editing enzyme APOBEC-3G (EC 3.5.4.38) (APOBEC-related cytidine deaminase) (APOBEC-related protein) (ARCD) (APOBEC-related protein 9) (ARP-9) (CEM-15) (CEM15) (Deoxycytidine deaminase) (A3G)
• Protein function: DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed:12808465, PubMed:16527742, PubMed:17121840, PubMed:18288108, PubMed:
• PDB: 2JYW , 2KBO , 2KEM , 3E1U , 3IQS , 3IR2 , 3V4J , 3V4K , 4ROV , 4ROW , 5ZVA , 5ZVB , 6BUX , 6BWY , 6K3J , 6K3K , 7UXD , 8CX0 , 8CX1 , 8CX2 , 8H0I , 8J62
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05240	APOBEC_C	303 → 379		Domain
  PF18782	NAD2	10 → 193		Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid a
• Sequence:

  MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYS
  ELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFV
  ARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPK
  YYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRG
  FLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
  KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQP
  WDGLDEHSQDLSGRLRAILQNQEN

• Sequence length: 384

Pathways

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	Vif-mediated degradation of APOBEC3G
Human immunodeficiency virus 1 infection	APOBEC3G mediated resistance to HIV-1 infection

Related Genes

Sort by: Blended Diseases Pathways Evidence source

APOBEC3D 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3F 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. TRIM5 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3A_B 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3H 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
APOBEC3D	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3F	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
TRIM5	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3A_B	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3H	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]

Diseases Linked via Similar Genes

Coronary artery disease Linked via 1 of 5 related genesTRIM5 Head and neck neoplasms Linked via 1 of 5 related genesTRIM5 Intracerebral hemorrhage Linked via 1 of 5 related genesTRIM5 Myocardial infarction Linked via 1 of 5 related genesTRIM5 Neuroblastoma Linked via 1 of 5 related genesTRIM5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Coronary artery disease	1	["TRIM5"]
Head and neck neoplasms	1	["TRIM5"]
Intracerebral hemorrhage	1	["TRIM5"]
Myocardial infarction	1	["TRIM5"]
Neuroblastoma	1	["TRIM5"]