APOBEC3D (apolipoprotein B mRNA editing enzyme catalytic subunit 3D)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 140564
• Gene name: Apolipoprotein B mRNA editing enzyme catalytic subunit 3D
• Gene symbol: APOBEC3D
• Synonyms (NCBI Gene): A3D, A3DE, APOBEC3DE, APOBEC3E, ARP6
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally

miRNA Show/Hide all (129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT532671	hsa-miR-3145-5p	PAR-CLIP	22012620
MIRT532669	hsa-miR-508-5p	PAR-CLIP	22012620
MIRT532668	hsa-miR-1306-5p	PAR-CLIP	22012620
MIRT532667	hsa-miR-6849-3p	PAR-CLIP	22012620
MIRT532666	hsa-miR-4707-5p	PAR-CLIP	22012620
MIRT532665	hsa-miR-5587-3p	PAR-CLIP	22012620
MIRT532664	hsa-miR-766-3p	PAR-CLIP	22012620
MIRT532663	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT532662	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT532661	hsa-miR-6763-3p	PAR-CLIP	22012620
MIRT532671	hsa-miR-3145-5p	PAR-CLIP	22012620
MIRT532669	hsa-miR-508-5p	PAR-CLIP	22012620
MIRT532668	hsa-miR-1306-5p	PAR-CLIP	22012620
MIRT532667	hsa-miR-6849-3p	PAR-CLIP	22012620
MIRT532666	hsa-miR-4707-5p	PAR-CLIP	22012620
MIRT532665	hsa-miR-5587-3p	PAR-CLIP	22012620
MIRT532664	hsa-miR-766-3p	PAR-CLIP	22012620
MIRT532663	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT532662	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT532661	hsa-miR-6763-3p	PAR-CLIP	22012620
MIRT789835	hsa-miR-1226	CLIP-seq
MIRT789836	hsa-miR-1273f	CLIP-seq
MIRT789837	hsa-miR-149	CLIP-seq
MIRT789838	hsa-miR-3064-5p	CLIP-seq
MIRT789839	hsa-miR-3122	CLIP-seq
MIRT789840	hsa-miR-3126-3p	CLIP-seq
MIRT789841	hsa-miR-3160-3p	CLIP-seq
MIRT789842	hsa-miR-3689a-3p	CLIP-seq
MIRT789843	hsa-miR-3689c	CLIP-seq
MIRT789844	hsa-miR-3913-5p	CLIP-seq
MIRT789845	hsa-miR-3918	CLIP-seq
MIRT789846	hsa-miR-4269	CLIP-seq
MIRT789847	hsa-miR-4484	CLIP-seq
MIRT789848	hsa-miR-4487	CLIP-seq
MIRT789849	hsa-miR-4514	CLIP-seq
MIRT789850	hsa-miR-4640-5p	CLIP-seq
MIRT789851	hsa-miR-4685-5p	CLIP-seq
MIRT789852	hsa-miR-4692	CLIP-seq
MIRT789853	hsa-miR-4715-3p	CLIP-seq
MIRT789854	hsa-miR-4726-5p	CLIP-seq
MIRT789855	hsa-miR-4733-3p	CLIP-seq
MIRT789856	hsa-miR-4742-5p	CLIP-seq
MIRT789857	hsa-miR-4756-3p	CLIP-seq
MIRT789858	hsa-miR-4794	CLIP-seq
MIRT789859	hsa-miR-552	CLIP-seq
MIRT789860	hsa-miR-558	CLIP-seq
MIRT789861	hsa-miR-764	CLIP-seq
MIRT789862	hsa-miR-940	CLIP-seq
MIRT789836	hsa-miR-1273f	CLIP-seq
MIRT1932987	hsa-miR-129-5p	CLIP-seq
MIRT789837	hsa-miR-149	CLIP-seq
MIRT789838	hsa-miR-3064-5p	CLIP-seq
MIRT1932988	hsa-miR-3119	CLIP-seq
MIRT789840	hsa-miR-3126-3p	CLIP-seq
MIRT1932989	hsa-miR-3156-3p	CLIP-seq
MIRT789841	hsa-miR-3160-3p	CLIP-seq
MIRT1932990	hsa-miR-3622a-3p	CLIP-seq
MIRT1932991	hsa-miR-3622b-3p	CLIP-seq
MIRT1932992	hsa-miR-3926	CLIP-seq
MIRT1932993	hsa-miR-4301	CLIP-seq
MIRT1932994	hsa-miR-4433	CLIP-seq
MIRT1932995	hsa-miR-4459	CLIP-seq
MIRT789848	hsa-miR-4487	CLIP-seq
MIRT1932996	hsa-miR-4768-3p	CLIP-seq
MIRT789858	hsa-miR-4794	CLIP-seq
MIRT1932997	hsa-miR-532-3p	CLIP-seq
MIRT1932998	hsa-miR-544b	CLIP-seq
MIRT1932999	hsa-miR-548s	CLIP-seq
MIRT789860	hsa-miR-558	CLIP-seq
MIRT2173146	hsa-miR-1193	CLIP-seq
MIRT789836	hsa-miR-1273f	CLIP-seq
MIRT2173147	hsa-miR-185	CLIP-seq
MIRT2173148	hsa-miR-3130-5p	CLIP-seq
MIRT2173149	hsa-miR-3150a-3p	CLIP-seq
MIRT2173150	hsa-miR-3165	CLIP-seq
MIRT2173151	hsa-miR-3169	CLIP-seq
MIRT2173152	hsa-miR-3175	CLIP-seq
MIRT1932990	hsa-miR-3622a-3p	CLIP-seq
MIRT1932991	hsa-miR-3622b-3p	CLIP-seq
MIRT2173153	hsa-miR-3689d	CLIP-seq
MIRT2173154	hsa-miR-3691-5p	CLIP-seq
MIRT1932992	hsa-miR-3926	CLIP-seq
MIRT2173155	hsa-miR-4306	CLIP-seq
MIRT1932994	hsa-miR-4433	CLIP-seq
MIRT1932995	hsa-miR-4459	CLIP-seq
MIRT2173156	hsa-miR-4482	CLIP-seq
MIRT2173157	hsa-miR-4515	CLIP-seq
MIRT2173158	hsa-miR-4534	CLIP-seq
MIRT2173159	hsa-miR-4644	CLIP-seq
MIRT2173160	hsa-miR-4667-5p	CLIP-seq
MIRT2173161	hsa-miR-4700-5p	CLIP-seq
MIRT789857	hsa-miR-4756-3p	CLIP-seq
MIRT1932996	hsa-miR-4768-3p	CLIP-seq
MIRT1932998	hsa-miR-544b	CLIP-seq
MIRT1932999	hsa-miR-548s	CLIP-seq
MIRT2173162	hsa-miR-939	CLIP-seq
MIRT2173146	hsa-miR-1193	CLIP-seq
MIRT2173147	hsa-miR-185	CLIP-seq
MIRT2173149	hsa-miR-3150a-3p	CLIP-seq
MIRT2173150	hsa-miR-3165	CLIP-seq
MIRT2173151	hsa-miR-3169	CLIP-seq
MIRT2173152	hsa-miR-3175	CLIP-seq
MIRT2173153	hsa-miR-3689d	CLIP-seq
MIRT2173154	hsa-miR-3691-5p	CLIP-seq
MIRT2173155	hsa-miR-4306	CLIP-seq
MIRT2173157	hsa-miR-4515	CLIP-seq
MIRT2173158	hsa-miR-4534	CLIP-seq
MIRT2173159	hsa-miR-4644	CLIP-seq
MIRT2173160	hsa-miR-4667-5p	CLIP-seq
MIRT2173161	hsa-miR-4700-5p	CLIP-seq
MIRT2173162	hsa-miR-939	CLIP-seq
MIRT2443804	hsa-miR-1273	CLIP-seq
MIRT2443805	hsa-miR-1285	CLIP-seq
MIRT2443806	hsa-miR-25	CLIP-seq
MIRT2443807	hsa-miR-3187-5p	CLIP-seq
MIRT2443808	hsa-miR-32	CLIP-seq
MIRT2443809	hsa-miR-3613-3p	CLIP-seq
MIRT2443810	hsa-miR-363	CLIP-seq
MIRT2443811	hsa-miR-367	CLIP-seq
MIRT2443812	hsa-miR-371-5p	CLIP-seq
MIRT2443813	hsa-miR-371b-5p	CLIP-seq
MIRT2443814	hsa-miR-378g	CLIP-seq
MIRT2443815	hsa-miR-4325	CLIP-seq
MIRT2443816	hsa-miR-4486	CLIP-seq
MIRT2443817	hsa-miR-4649-5p	CLIP-seq
MIRT2443818	hsa-miR-554	CLIP-seq
MIRT2443819	hsa-miR-612	CLIP-seq
MIRT2443820	hsa-miR-92a	CLIP-seq
MIRT2443821	hsa-miR-92b	CLIP-seq

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IBA
GO:0000932	Component	P-body	IDA	22915799
GO:0000932	Component	P-body	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003824	Function	Catalytic activity	IEA
GO:0004126	Function	Cytidine deaminase activity	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21835787
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016554	Process	Cytidine to uridine editing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0044355	Process	Clearance of foreign intracellular DNA	IDA	20062055
GO:0044355	Process	Clearance of foreign intracellular DNA	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	21835787
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IDA	21835787
GO:0051607	Process	Defense response to virus	IEA
GO:0070383	Process	DNA cytosine deamination	IBA
GO:0070383	Process	DNA cytosine deamination	IDA	21835787

Other IDs

• MIM: 609900
• HGNC: 17354
• e!Ensembl: ENSG00000243811

Protein

• UniProt ID: Q96AK3
• Protein name: DNA dC->dU-editing enzyme APOBEC-3D (A3D) (A3DE) (EC 3.5.4.38)
• Protein function: DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed:16920826, PubMed:20062055, PubMed:21835787). Exhibits antiviral acti
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18782	NAD2	206 → 385		Family
  PF18782	NAD2	10 → 201		Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lymphoid organs. Also detected in non-lymphoid tissues including lung. {ECO:0000269|PubMed:20308164}.
• Sequence:

  MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVL
  PKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFL
  AEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPF
  MPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKH
  HSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEV
  AEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSD
  DEPFKPWKGLQTNFRLLKRRLREILQ

• Sequence length: 386

Pathways

KEGG Pathway

Viral life cycle - HIV-1

Human immunodeficiency virus 1 infection

Related Genes

Sort by: Blended Diseases Pathways Evidence source

APOBEC3F 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. TRIM5 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3A_B 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3H 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection. APOBEC3A 2 shared pathwaysViral life cycle - HIV-1, Human immunodeficiency virus 1 infection Related via 2 shared pathways including Viral life cycle - HIV-1, Human immunodeficiency virus 1 infection.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
APOBEC3F	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
TRIM5	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3A_B	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3H	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]
APOBEC3A	0	[]	2	["Viral life cycle - HIV-1","Human immunodeficiency virus 1 infection"]	0	[]

Diseases Linked via Similar Genes

Coronary artery disease Linked via 1 of 5 related genesTRIM5 Head and neck neoplasms Linked via 1 of 5 related genesTRIM5 Intracerebral hemorrhage Linked via 1 of 5 related genesTRIM5 Myocardial infarction Linked via 1 of 5 related genesTRIM5 Neuroblastoma Linked via 1 of 5 related genesTRIM5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Coronary artery disease	1	["TRIM5"]
Head and neck neoplasms	1	["TRIM5"]
Intracerebral hemorrhage	1	["TRIM5"]
Myocardial infarction	1	["TRIM5"]
Neuroblastoma	1	["TRIM5"]