AKR7L (aldo-keto reductase family 7 like (gene/pseudogene))

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 246181
• Gene name: Aldo-keto reductase family 7 like (gene/pseudogene)
• Gene symbol: AKR7L
• Synonyms (NCBI Gene): AFAR3, AFB1-AR 3, AFB1-AR3, AKR7A4
• Chromosome: 1
• Chromosome location: 1p36.13|1p35-p36.1
• Summary: This gene is one of three aldo-keto reductase genes that are present in a cluster on the p arm of chromosome 1. The encoded proteins are involved in the reduction of the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialco

miRNA Show/Hide all (177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025393	hsa-miR-34a-5p	Proteomics	21566225
MIRT025393	hsa-miR-34a-5p	Proteomics	21566225
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672835	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT672834	hsa-miR-5691	HITS-CLIP	23824327
MIRT672833	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT643750	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	PAR-CLIP	27292025
MIRT625396	hsa-miR-122-5p	PAR-CLIP	27292025
MIRT625393	hsa-miR-143-5p	PAR-CLIP	27292025
MIRT625398	hsa-miR-3135b	PAR-CLIP	27292025
MIRT672835	hsa-miR-3194-3p	PAR-CLIP	27292025
MIRT625395	hsa-miR-3652	PAR-CLIP	27292025
MIRT625394	hsa-miR-4430	PAR-CLIP	27292025
MIRT625397	hsa-miR-504-3p	PAR-CLIP	27292025
MIRT672834	hsa-miR-5691	PAR-CLIP	27292025
MIRT625401	hsa-miR-5693	PAR-CLIP	27292025
MIRT625391	hsa-miR-5698	PAR-CLIP	27292025
MIRT625399	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT672833	hsa-miR-6805-3p	PAR-CLIP	27292025
MIRT643750	hsa-miR-6854-5p	PAR-CLIP	27292025
MIRT625402	hsa-miR-7705	PAR-CLIP	27292025
MIRT625392	hsa-miR-891a-3p	PAR-CLIP	27292025
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672835	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT672834	hsa-miR-5691	HITS-CLIP	23824327
MIRT672833	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT643750	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT625402	hsa-miR-7705	HITS-CLIP	23824327
MIRT625401	hsa-miR-5693	HITS-CLIP	23824327
MIRT625400	hsa-miR-103b	HITS-CLIP	23824327
MIRT625399	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT625398	hsa-miR-3135b	HITS-CLIP	23824327
MIRT625397	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT625396	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT625395	hsa-miR-3652	HITS-CLIP	23824327
MIRT625394	hsa-miR-4430	HITS-CLIP	23824327
MIRT625393	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT625392	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT625391	hsa-miR-5698	HITS-CLIP	23824327
MIRT776385	hsa-miR-1267	CLIP-seq
MIRT776386	hsa-miR-3613-5p	CLIP-seq
MIRT776387	hsa-miR-483-3p	CLIP-seq
MIRT776388	hsa-miR-499a-5p	CLIP-seq
MIRT776389	hsa-miR-508-5p	CLIP-seq
MIRT776390	hsa-miR-568	CLIP-seq
MIRT776391	hsa-miR-633	CLIP-seq
MIRT776392	hsa-miR-3121-5p	CLIP-seq
MIRT776393	hsa-miR-452	CLIP-seq
MIRT776394	hsa-miR-4676-3p	CLIP-seq
MIRT776395	hsa-miR-4738-3p	CLIP-seq
MIRT776396	hsa-miR-501-5p	CLIP-seq
MIRT776397	hsa-miR-539	CLIP-seq
MIRT776398	hsa-miR-548g	CLIP-seq
MIRT776399	hsa-miR-580	CLIP-seq
MIRT1929142	hsa-miR-106a	CLIP-seq
MIRT1929143	hsa-miR-106b	CLIP-seq
MIRT1929144	hsa-miR-1207-3p	CLIP-seq
MIRT1929145	hsa-miR-122	CLIP-seq
MIRT1929146	hsa-miR-17	CLIP-seq
MIRT1929147	hsa-miR-20a	CLIP-seq
MIRT1929148	hsa-miR-20b	CLIP-seq
MIRT1929149	hsa-miR-302a	CLIP-seq
MIRT1929150	hsa-miR-302b	CLIP-seq
MIRT1929151	hsa-miR-302c	CLIP-seq
MIRT1929152	hsa-miR-302d	CLIP-seq
MIRT1929153	hsa-miR-302e	CLIP-seq
MIRT1929154	hsa-miR-3199	CLIP-seq
MIRT776386	hsa-miR-3613-5p	CLIP-seq
MIRT1929155	hsa-miR-371-5p	CLIP-seq
MIRT1929156	hsa-miR-371b-5p	CLIP-seq
MIRT1929157	hsa-miR-372	CLIP-seq
MIRT1929158	hsa-miR-373	CLIP-seq
MIRT1929159	hsa-miR-3973	CLIP-seq
MIRT1929160	hsa-miR-4307	CLIP-seq
MIRT1929161	hsa-miR-4659a-5p	CLIP-seq
MIRT1929162	hsa-miR-4659b-5p	CLIP-seq
MIRT1929163	hsa-miR-4663	CLIP-seq
MIRT1929164	hsa-miR-4740-3p	CLIP-seq
MIRT1929165	hsa-miR-4757-5p	CLIP-seq
MIRT1929166	hsa-miR-512-3p	CLIP-seq
MIRT1929167	hsa-miR-519d	CLIP-seq
MIRT1929168	hsa-miR-520a-3p	CLIP-seq
MIRT1929169	hsa-miR-520b	CLIP-seq
MIRT1929170	hsa-miR-520c-3p	CLIP-seq
MIRT1929171	hsa-miR-520d-3p	CLIP-seq
MIRT1929172	hsa-miR-520e	CLIP-seq
MIRT1929173	hsa-miR-520g	CLIP-seq
MIRT1929174	hsa-miR-520h	CLIP-seq
MIRT1929175	hsa-miR-552	CLIP-seq
MIRT1929176	hsa-miR-646	CLIP-seq
MIRT1929177	hsa-miR-93	CLIP-seq
MIRT1929145	hsa-miR-122	CLIP-seq
MIRT2169816	hsa-miR-3189-3p	CLIP-seq
MIRT2169817	hsa-miR-3200-3p	CLIP-seq
MIRT776386	hsa-miR-3613-5p	CLIP-seq
MIRT2169818	hsa-miR-4293	CLIP-seq
MIRT2169819	hsa-miR-4724-3p	CLIP-seq
MIRT2169820	hsa-miR-4789-5p	CLIP-seq
MIRT2169821	hsa-miR-630	CLIP-seq
MIRT2169822	hsa-miR-635	CLIP-seq
MIRT2169823	hsa-miR-759	CLIP-seq
MIRT2472666	hsa-miR-1299	CLIP-seq
MIRT2472667	hsa-miR-3152-5p	CLIP-seq
MIRT1929155	hsa-miR-371-5p	CLIP-seq
MIRT2472668	hsa-miR-378	CLIP-seq
MIRT2472669	hsa-miR-378b	CLIP-seq
MIRT2472670	hsa-miR-378c	CLIP-seq
MIRT2472671	hsa-miR-378d	CLIP-seq
MIRT2472672	hsa-miR-378e	CLIP-seq
MIRT2472673	hsa-miR-378f	CLIP-seq
MIRT2472674	hsa-miR-378h	CLIP-seq
MIRT2472675	hsa-miR-378i	CLIP-seq
MIRT2472676	hsa-miR-422a	CLIP-seq
MIRT2472677	hsa-miR-4638-3p	CLIP-seq
MIRT2472678	hsa-miR-4774-3p	CLIP-seq
MIRT2472679	hsa-miR-4778-5p	CLIP-seq
MIRT2472680	hsa-miR-4782-5p	CLIP-seq
MIRT2472681	hsa-miR-516b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 608478
• HGNC: 24056
• e!Ensembl: ENSG00000211454

Protein

• UniProt ID: Q8NHP1
• Protein name: Aflatoxin B1 aldehyde reductase member 4 (EC 1.-.-.-) (AFB1 aldehyde reductase 3) (AFB1-AR 3) (Aldoketoreductase 7-like)
• Protein function: Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen (By similarity). {ECO:0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	12 → 320	Aldo/keto reductase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in uterus. {ECO:0000269|PubMed:12879023}.
• Sequence:

  MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGG
  LGLRMGSSDCRVKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHSAP
  VEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVE
  TELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGTQWAEIYRNHFWKEH
  HFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA
  AAEEGPLEPAVVDAFNQAWHLFAHECPNYFI

• Sequence length: 331

Pathways

KEGG Pathway:

Metabolism of xenobiotics by cytochrome P450

Reactome Pathway:

Aflatoxin activation and detoxification

Related Genes

Sort by: Blended Diseases Pathways Evidence source

AKR7A3 2 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification Related via 2 shared pathways including Metabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification. AKR7A2 2 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification Related via 2 shared pathways including Metabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification. CYP2A13 2 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification Related via 2 shared pathways including Metabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification. CYP3A5 2 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification Related via 2 shared pathways including Metabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification. CYP3A4 2 shared pathwaysMetabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification Related via 2 shared pathways including Metabolism of xenobiotics by cytochrome P450, Aflatoxin activation and detoxification.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
AKR7A3	0	[]	2	["Metabolism of xenobiotics by cytochrome P450","Aflatoxin activation and detoxification"]	0	[]
AKR7A2	0	[]	2	["Metabolism of xenobiotics by cytochrome P450","Aflatoxin activation and detoxification"]	0	[]
CYP2A13	0	[]	2	["Metabolism of xenobiotics by cytochrome P450","Aflatoxin activation and detoxification"]	0	[]
CYP3A5	0	[]	2	["Metabolism of xenobiotics by cytochrome P450","Aflatoxin activation and detoxification"]	0	[]
CYP3A4	0	[]	2	["Metabolism of xenobiotics by cytochrome P450","Aflatoxin activation and detoxification"]	0	[]

Diseases Linked via Similar Genes

Autism Linked via 4 of 5 related genesAKR7A3, AKR7A2, CYP2A13, CYP3A5 Prostatic neoplasms Linked via 2 of 5 related genesCYP3A5, CYP3A4 Schizophrenia Linked via 2 of 5 related genesCYP3A5, CYP3A4 Hepatomegaly Linked via 1 of 5 related genesAKR7A3 Alzheimer disease Linked via 1 of 5 related genesAKR7A3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	4	["AKR7A3","AKR7A2","CYP2A13","CYP3A5"]
Prostatic neoplasms	2	["CYP3A5","CYP3A4"]
Schizophrenia	2	["CYP3A5","CYP3A4"]
Hepatomegaly	1	["AKR7A3"]
Alzheimer disease	1	["AKR7A3"]