Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	64902
Gene name	Alanine--glyoxylate aminotransferase 2
Gene symbol	AGXT2
Synonyms (NCBI Gene)	AGT2BAIBADAIBAT
Chromosome	5
Chromosome location	5p13.2
Summary	The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. It is an important regulator of methylarginines and is i

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs37369	C>T	Affects	Coding sequence variant, missense variant

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019037	hsa-miR-335-5p	Microarray	18185580
MIRT696668	hsa-miR-606	HITS-CLIP	23313552
MIRT682038	hsa-miR-3929	HITS-CLIP	23313552
MIRT682037	hsa-miR-4419b	HITS-CLIP	23313552
MIRT682036	hsa-miR-4478	HITS-CLIP	23313552
MIRT682035	hsa-miR-6760-5p	HITS-CLIP	23313552
MIRT682034	hsa-miR-1321	HITS-CLIP	23313552
MIRT682033	hsa-miR-4739	HITS-CLIP	23313552
MIRT682032	hsa-miR-4756-5p	HITS-CLIP	23313552
MIRT682030	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT682028	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT682027	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT682026	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT682025	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT682024	hsa-miR-6735-3p	HITS-CLIP	23313552
MIRT682023	hsa-miR-3162-5p	HITS-CLIP	23313552
MIRT682022	hsa-miR-665	HITS-CLIP	23313552
MIRT696667	hsa-miR-6888-5p	HITS-CLIP	23313552
MIRT696666	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT696665	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT682041	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT682040	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT682039	hsa-miR-940	HITS-CLIP	23313552
MIRT696664	hsa-miR-4461	HITS-CLIP	23313552
MIRT696663	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT682031	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT696662	hsa-miR-4459	HITS-CLIP	23313552
MIRT696661	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT696660	hsa-miR-4514	HITS-CLIP	23313552
MIRT696659	hsa-miR-4692	HITS-CLIP	23313552
MIRT696658	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT696657	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT696656	hsa-miR-5186	HITS-CLIP	23313552
MIRT682029	hsa-miR-1827	HITS-CLIP	23313552
MIRT696655	hsa-miR-6089	HITS-CLIP	23313552
MIRT696654	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT696653	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT696652	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT696651	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT696650	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT696649	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT696648	hsa-miR-3672	HITS-CLIP	23313552
MIRT696647	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT696646	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT696645	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT696644	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT696643	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT696642	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT696641	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT696640	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT696639	hsa-miR-3689c	HITS-CLIP	23313552
MIRT696638	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT696637	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT696636	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT696635	hsa-miR-3122	HITS-CLIP	23313552
MIRT696634	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT696633	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT696632	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT682041	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682040	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682039	hsa-miR-940	HITS-CLIP	23706177
MIRT682038	hsa-miR-3929	HITS-CLIP	23706177
MIRT682037	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682036	hsa-miR-4478	HITS-CLIP	23706177
MIRT682035	hsa-miR-6760-5p	HITS-CLIP	23706177
MIRT682034	hsa-miR-1321	HITS-CLIP	23706177
MIRT682033	hsa-miR-4739	HITS-CLIP	23706177
MIRT682032	hsa-miR-4756-5p	HITS-CLIP	23706177
MIRT682031	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682030	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682029	hsa-miR-1827	HITS-CLIP	23706177
MIRT682028	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682027	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682026	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682025	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682024	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682023	hsa-miR-3162-5p	HITS-CLIP	23706177
MIRT682022	hsa-miR-665	HITS-CLIP	23706177
MIRT696668	hsa-miR-606	HITS-CLIP	23313552
MIRT682038	hsa-miR-3929	HITS-CLIP	23313552
MIRT682037	hsa-miR-4419b	HITS-CLIP	23313552
MIRT682036	hsa-miR-4478	HITS-CLIP	23313552
MIRT682035	hsa-miR-6760-5p	HITS-CLIP	23313552
MIRT682034	hsa-miR-1321	HITS-CLIP	23313552
MIRT682033	hsa-miR-4739	HITS-CLIP	23313552
MIRT682032	hsa-miR-4756-5p	HITS-CLIP	23313552
MIRT682030	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT682028	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT682027	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT682026	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT682025	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT682024	hsa-miR-6735-3p	HITS-CLIP	23313552
MIRT682023	hsa-miR-3162-5p	HITS-CLIP	23313552
MIRT682022	hsa-miR-665	HITS-CLIP	23313552
MIRT696667	hsa-miR-6888-5p	HITS-CLIP	23313552
MIRT696666	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT696665	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT682041	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT682040	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT682039	hsa-miR-940	HITS-CLIP	23313552
MIRT696664	hsa-miR-4461	HITS-CLIP	23313552
MIRT696663	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT682031	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT696662	hsa-miR-4459	HITS-CLIP	23313552
MIRT696661	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT696660	hsa-miR-4514	HITS-CLIP	23313552
MIRT696659	hsa-miR-4692	HITS-CLIP	23313552
MIRT696658	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT696657	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT696656	hsa-miR-5186	HITS-CLIP	23313552
MIRT682029	hsa-miR-1827	HITS-CLIP	23313552
MIRT696655	hsa-miR-6089	HITS-CLIP	23313552
MIRT696654	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT696653	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT696652	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT696651	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT696650	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT696649	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT696648	hsa-miR-3672	HITS-CLIP	23313552
MIRT696647	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT696646	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT696645	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT696644	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT696643	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT696642	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT696641	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT696640	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT696639	hsa-miR-3689c	HITS-CLIP	23313552
MIRT696638	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT696637	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT696636	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT696635	hsa-miR-3122	HITS-CLIP	23313552
MIRT696634	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT696633	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT696632	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT682041	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682040	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682039	hsa-miR-940	HITS-CLIP	23706177
MIRT682038	hsa-miR-3929	HITS-CLIP	23706177
MIRT682037	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682036	hsa-miR-4478	HITS-CLIP	23706177
MIRT682035	hsa-miR-6760-5p	HITS-CLIP	23706177
MIRT682034	hsa-miR-1321	HITS-CLIP	23706177
MIRT682033	hsa-miR-4739	HITS-CLIP	23706177
MIRT682032	hsa-miR-4756-5p	HITS-CLIP	23706177
MIRT682031	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682030	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682029	hsa-miR-1827	HITS-CLIP	23706177
MIRT682028	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682027	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682026	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682025	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682024	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682023	hsa-miR-3162-5p	HITS-CLIP	23706177
MIRT682022	hsa-miR-665	HITS-CLIP	23706177
MIRT773202	hsa-miR-3194-3p	CLIP-seq
MIRT773203	hsa-miR-495	CLIP-seq
MIRT773204	hsa-miR-584	CLIP-seq
MIRT773205	hsa-miR-760	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	20018850, 24586340, 31818439
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0008453	Function	Alanine-glyoxylate transaminase activity	IBA
GO:0008453	Function	Alanine-glyoxylate transaminase activity	IDA	20018850, 24586340
GO:0008453	Function	Alanine-glyoxylate transaminase activity	IEA
GO:0008483	Function	Transaminase activity	IEA
GO:0009436	Process	Glyoxylate catabolic process	IBA
GO:0009436	Process	Glyoxylate catabolic process	IDA	20018850
GO:0016223	Function	Beta-alanine:pyruvate transaminase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019265	Process	Glycine biosynthetic process, by transamination of glyoxylate	IDA	20018850
GO:0019481	Process	L-alanine catabolic process, by transamination	IBA
GO:0019481	Process	L-alanine catabolic process, by transamination	IDA	20018850
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	20018850
GO:0047305	Function	(R)-3-amino-2-methylpropionate-pyruvate transaminase activity	IDA	24586340
GO:0047305	Function	(R)-3-amino-2-methylpropionate-pyruvate transaminase activity	IEA
GO:2001299	Process	N(omega),N(omega)-dimethyl-L-arginine catabolic process	IEA
GO:2001299	Process	N(omega),N(omega)-dimethyl-L-arginine catabolic process	ISS

MIM	HGNC	e!Ensembl
612471	14412	ENSG00000113492

Q9BYV1

Protein name

Alanine--glyoxylate aminotransferase 2, mitochondrial (AGT 2) (EC 2.6.1.44) ((R)-3-amino-2-methylpropionate--pyruvate transaminase) (EC 2.6.1.40) (Beta-ALAAT II) (Beta-alanine-pyruvate aminotransferase) (EC 2.6.1.18) (D-3-aminoisobutyrate-pyruvate aminotr

Protein function

Multifunctional aminotransferase with a broad substrate specificity (PubMed:20018850, PubMed:23023372, PubMed:24586340). Catalyzes the conversion of glyoxylate to glycine using alanine as the amino donor (By similarity). Catalyzes metabolism of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00202	Aminotran_3	79 → 505	Aminotransferase class-III	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the convoluted tubule in the kidney and in the liver hepatocytes (at protein level). {ECO:0000269|PubMed:31818439}.

Sequence

MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQS
LGYNRVLEIHKEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCH
PKVNAVAQKQLGRLWHTSTVFFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLM
ARAHSNNIDIISFRGAYHGCSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSH
CRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK
GFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK
LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQT
FRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK

Sequence length

514

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Beta-aminoisobutyric acid, urinary excretion of	Uncertain significance; Affects	ClinVar ClinVar, Disgenet ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BETA-AMINOISOBUTYRIC ACIDURIA	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERMITTENT CLAUDICATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MILD COGNITIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	25620171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25620171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26984639		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	26984639	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37657024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24186881, 25245031, 27423328, 28970090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26984639	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	25245031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	27423328, 28942034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29982953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27423328, 28942034		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24834905, 30284143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	24834905, 30284143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24834905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24834905, 30284143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24834905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24834905, 35961823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24186881, 27752141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33879046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23023372, 25620171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	CTD_human_DG	21572414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26984639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28942034, 28970090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27914500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33879046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31839812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29573947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28357606, 31062169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24727203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	25245031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	26984639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33879046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AGXT2 (alanine--glyoxylate aminotransferase 2)