Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23266
Gene name	Adhesion G protein-coupled receptor L2
Gene symbol	ADGRL2
Synonyms (NCBI Gene)	CIRL2CL2LEC1LPHH1LPHN2
Chromosome	1
Chromosome location	1p31.1
Summary	This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors. The encoded protein participates in the regulation of exocytosis. The proprotein is thought to be further cleaved within a cysteine-rich G-protein-coupled receptor pro

134 Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT740666	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT740667	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT740668	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT740669	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT740670	hsa-miR-3924	HITS-CLIP	21572407
MIRT740666	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT740667	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT740668	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT740669	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT740670	hsa-miR-3924	HITS-CLIP	21572407
MIRT740956	hsa-miR-490-3p	HITS-CLIP	23313552
MIRT740957	hsa-miR-7851-3p	HITS-CLIP	23313552
MIRT740958	hsa-miR-216b-3p	HITS-CLIP	23313552
MIRT740959	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT740960	hsa-miR-589-5p	HITS-CLIP	23313552
MIRT740961	hsa-miR-146a-5p	HITS-CLIP	23313552
MIRT740962	hsa-miR-146b-5p	HITS-CLIP	23313552
MIRT740963	hsa-miR-7153-5p	HITS-CLIP	23313552
MIRT740964	hsa-miR-4537	HITS-CLIP	23313552
MIRT740965	hsa-miR-6087	HITS-CLIP	23313552
MIRT740966	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT740967	hsa-miR-6086	HITS-CLIP	23313552
MIRT740968	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT740969	hsa-miR-658	HITS-CLIP	23313552
MIRT740970	hsa-miR-25-5p	HITS-CLIP	23313552
MIRT740971	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT740972	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT740973	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT740974	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT740975	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT740976	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT740977	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT740978	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT740979	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT740980	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT740981	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT740982	hsa-miR-3689c	HITS-CLIP	23313552
MIRT740983	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT740984	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT740985	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT740986	hsa-miR-4459	HITS-CLIP	23313552
MIRT741941	hsa-miR-8485	HITS-CLIP	23824327
MIRT741942	hsa-miR-6782-5p	HITS-CLIP	23824327
MIRT741943	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT741944	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT741945	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT741946	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT741947	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT741948	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT741949	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT741950	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT741951	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT741952	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT741953	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT741954	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT741955	hsa-miR-526a	HITS-CLIP	23824327
MIRT741956	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT740666	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT740667	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT740668	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT740669	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT740670	hsa-miR-3924	PAR-CLIP	20371350
MIRT754136	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT754137	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT754138	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT754139	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT754140	hsa-miR-335-5p	PAR-CLIP	20371350
MIRT754141	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT754142	hsa-miR-5096	PAR-CLIP	20371350
MIRT754136	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT754137	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT754230	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT754138	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT754139	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT754140	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT754231	hsa-miR-16-2-3p	PAR-CLIP	21572407
MIRT754232	hsa-miR-195-3p	PAR-CLIP	21572407
MIRT754233	hsa-miR-4639-3p	PAR-CLIP	21572407
MIRT754234	hsa-miR-412-3p	PAR-CLIP	21572407
MIRT754235	hsa-miR-6754-3p	PAR-CLIP	21572407
MIRT754236	hsa-miR-6837-3p	PAR-CLIP	21572407
MIRT754141	hsa-miR-513b-5p	PAR-CLIP	21572407
MIRT754237	hsa-miR-6794-3p	PAR-CLIP	21572407
MIRT754238	hsa-miR-6875-3p	PAR-CLIP	21572407
MIRT754239	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT754240	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT754142	hsa-miR-5096	PAR-CLIP	21572407
MIRT740666	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT740667	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT740668	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT740669	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT740670	hsa-miR-3924	PAR-CLIP	21572407
MIRT754136	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT754137	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT754138	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT754139	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT754140	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT754141	hsa-miR-513b-5p	PAR-CLIP	21572407
MIRT754142	hsa-miR-5096	PAR-CLIP	21572407
MIRT740666	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT740667	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT740668	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT740669	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT740670	hsa-miR-3924	PAR-CLIP	21572407
MIRT754432	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT754433	hsa-miR-3714	PAR-CLIP	22012620
MIRT754434	hsa-miR-3910	PAR-CLIP	22012620
MIRT754435	hsa-miR-4475	PAR-CLIP	22012620
MIRT754436	hsa-miR-3200-3p	PAR-CLIP	22012620
MIRT754437	hsa-miR-6813-3p	PAR-CLIP	22012620
MIRT754432	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT754438	hsa-miR-506-3p	PAR-CLIP	22012620
MIRT754439	hsa-miR-6892-5p	PAR-CLIP	22012620
MIRT754440	hsa-miR-4477b	PAR-CLIP	22012620
MIRT754441	hsa-miR-7856-5p	PAR-CLIP	22012620
MIRT740666	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT740667	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT740668	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT754603	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT754604	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT740669	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT740670	hsa-miR-3924	PAR-CLIP	23446348
MIRT754136	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT754137	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT754138	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT754139	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT754140	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT754141	hsa-miR-513b-5p	PAR-CLIP	23446348
MIRT754142	hsa-miR-5096	PAR-CLIP	23446348
MIRT740667	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT740668	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT740669	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT740670	hsa-miR-3924	PAR-CLIP	23446348
MIRT740666	hsa-miR-1277-5p	PAR-CLIP	23446348

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	10030676
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10030676
GO:0016020	Component	Membrane	TAS	15203201
GO:0016524	Function	Latrotoxin receptor activity	NAS	10030676
GO:0030246	Function	Carbohydrate binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	ISS
GO:1904861	Process	Excitatory synapse assembly	ISS

MIM	HGNC	e!Ensembl
607018	18582	ENSG00000117114

O95490

Protein name

Adhesion G protein-coupled receptor L2 (Calcium-independent alpha-latrotoxin receptor 2) (CIRL-2) (Latrophilin homolog 1) (Latrophilin-2) (Lectomedin-1)

Protein function

Orphan adhesion G-protein coupled receptor (aGPCR), which mediates synapse specificity (By similarity). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the ac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00002	7tm_2	844 → 1080	7 transmembrane receptor (Secretin family)	Family
PF01825	GPS	786 → 830	GPCR proteolysis site, GPS, motif	Motif
PF02140	Gal_Lectin	49 → 129	Galactose binding lectin domain	Domain
PF02191	OLF	140 → 392	Olfactomedin-like domain	Family
PF02354	Latrophilin	1100 → 1459	Latrophilin Cytoplasmic C-terminal region	Family
PF02793	HRM	466 → 524	Hormone receptor domain	Family
PF16489	GAIN	538 → 760	GPCR-Autoproteolysis INducing (GAIN) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed very widely in all normal tissues tested. Expression is variable in tumor cell lines, apparently elevated in some lines and absent or markedly reduced in others. {ECO:0000269|PubMed:10030676}.

Sequence

MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEA
TWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPN
QYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIIST
TSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWP
QTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAA
SLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQKREK
TCRAYLKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTR
VSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIY
RSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDP
DNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKD
GVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIG
IDKTKYAIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLF
PATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHS
NTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFI
FIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMW
NDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAP
SAPVFNSPGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLNDTAFE
KMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHH
KELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMPNLRD
SPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKE
GCIPEGDVREGQMQLVTSL

Sequence length

1459

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (44)
ADGRL2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	35851147	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER EXSTROPHY	—	GWAS catalog	36352089	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	38254997	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	38254997	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	34127677	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	26305897	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	36266505	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	35851147	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394, 33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	34162658	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33907183	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY MALIGNANT NEOPLASM	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256, 39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	28203683, 31420334	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (34)
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10760572		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22479588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	26511811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34972135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	29143724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	28459279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17434345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	26511811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10760572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26511811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28657541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26511811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26511811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10760572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30340542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microlissencephaly	Microlissencephaly	BEFREE	31770597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10030676, 27807832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	26868259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28657541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26511811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28657541	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC25A28	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Glomerulonephritis","Juvenile idiopathic arthritis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Glomerulonephritis)","GWAS catalog (Juvenile idiopathic arthritis)"]
CYTL1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
FNBP1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
SBK1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
NKX2-3	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Glomerulonephritis","Juvenile idiopathic arthritis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Glomerulonephritis)","GWAS catalog (Juvenile idiopathic arthritis)"]

ADGRL2 (adhesion G protein-coupled receptor L2)

Save This Analysis