Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	81894
Gene name	Solute carrier family 25 member 28
Gene symbol	SLC25A28
Synonyms (NCBI Gene)	MFRN2MRS3/4MRS4LNPD016
Chromosome	10
Chromosome location	10q24.2

65 Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029886	hsa-miR-26b-5p	Microarray	19088304
MIRT050990	hsa-miR-17-5p	CLASH	23622248
MIRT050611	hsa-miR-20a-5p	CLASH	23622248
MIRT456069	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT456068	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT456067	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT456066	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456065	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456064	hsa-miR-2392	PAR-CLIP	23592263
MIRT456063	hsa-miR-154-5p	PAR-CLIP	23592263
MIRT456062	hsa-miR-1972	PAR-CLIP	23592263
MIRT456061	hsa-miR-4650-5p	PAR-CLIP	23592263
MIRT456060	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT456059	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT456058	hsa-miR-4534	PAR-CLIP	23592263
MIRT456057	hsa-miR-8082	PAR-CLIP	23592263
MIRT456056	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT456055	hsa-miR-4306	PAR-CLIP	23592263
MIRT456054	hsa-miR-4644	PAR-CLIP	23592263
MIRT456053	hsa-miR-5192	PAR-CLIP	23592263
MIRT456052	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT456051	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT439615	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT439615	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT456069	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT456068	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT456067	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT456066	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456065	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456064	hsa-miR-2392	PAR-CLIP	23592263
MIRT456063	hsa-miR-154-5p	PAR-CLIP	23592263
MIRT456062	hsa-miR-1972	PAR-CLIP	23592263
MIRT456061	hsa-miR-4650-5p	PAR-CLIP	23592263
MIRT456060	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT456059	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT456058	hsa-miR-4534	PAR-CLIP	23592263
MIRT456057	hsa-miR-8082	PAR-CLIP	23592263
MIRT456056	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT456055	hsa-miR-4306	PAR-CLIP	23592263
MIRT456054	hsa-miR-4644	PAR-CLIP	23592263
MIRT456053	hsa-miR-5192	PAR-CLIP	23592263
MIRT456052	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT456051	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT1356103	hsa-miR-132	CLIP-seq
MIRT1356104	hsa-miR-154	CLIP-seq
MIRT1356105	hsa-miR-185	CLIP-seq
MIRT1356106	hsa-miR-18a	CLIP-seq
MIRT1356107	hsa-miR-18b	CLIP-seq
MIRT1356108	hsa-miR-212	CLIP-seq
MIRT1356109	hsa-miR-218	CLIP-seq
MIRT1356110	hsa-miR-2278	CLIP-seq
MIRT1356111	hsa-miR-3650	CLIP-seq
MIRT1356112	hsa-miR-518d-5p	CLIP-seq
MIRT1356113	hsa-miR-519b-5p	CLIP-seq
MIRT1356114	hsa-miR-519c-5p	CLIP-seq
MIRT1356115	hsa-miR-520c-5p	CLIP-seq
MIRT1356116	hsa-miR-526a	CLIP-seq
MIRT1356117	hsa-miR-636	CLIP-seq
MIRT1356103	hsa-miR-132	CLIP-seq
MIRT1356104	hsa-miR-154	CLIP-seq
MIRT1356105	hsa-miR-185	CLIP-seq
MIRT2329965	hsa-miR-188-5p	CLIP-seq
MIRT1356108	hsa-miR-212	CLIP-seq
MIRT2329966	hsa-miR-558	CLIP-seq
MIRT2329967	hsa-miR-642a	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005381	Function	Iron ion transmembrane transporter activity	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	11297739
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0015093	Function	Ferrous iron transmembrane transporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0048250	Process	Iron import into the mitochondrion	IBA

MIM	HGNC	e!Ensembl
609767	23472	ENSG00000155287

Q96A46

Protein name

Mitoferrin-2 (Mitochondrial RNA-splicing protein 3/4 homolog) (MRS3/4) (hMRS3/4) (Mitochondrial iron transporter 2) (Solute carrier family 25 member 28)

Protein function

Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	257 → 357	Mitochondrial carrier protein	Family
PF00153	Mito_carr	69 → 162	Mitochondrial carrier protein	Family
PF00153	Mito_carr	167 → 257	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed in placenta, lung, kidney, pancreas, liver, brain, skeletal muscle and heart. {ECO:0000269|PubMed:11297739}.

Sequence

MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSG
PDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR
IIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA
TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA
IHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSH
ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW
RAGK

Sequence length

364

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (19)
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	30510241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	24737748, 25990418, 26151821, 29917119, 30510241, 31089142, 36539618, 38872215	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26301688, 33686288, 37262302, 37523193	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863, 37492107	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	39266554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	37262302, 37523193, 39792054	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34782712	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	33686288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26301688, 37262302	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36750831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25256833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29625173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23135267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21672570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23135267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NKX2-3	8	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Colorectal adenoma","Common variable immunodeficiency","Glomerulonephritis","Diverticular disease","Juvenile idiopathic arthritis"]	[]	9	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Colorectal adenoma)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Diverticular disease)","GWAS catalog (Glomerulonephritis)","GWAS catalog (Juvenile idiopathic arthritis)"]
CYTL1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
FNBP1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
SBK1	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]
ATXN2L	5	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis"]	[]	6	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)"]

SLC25A28 (solute carrier family 25 member 28)

Bookmark This Gene