FZD8 (frizzled class receptor 8)

Gene

• Entrez ID: 8325
• Gene name: Frizzled class receptor 8
• Gene symbol: FZD8
• Synonyms (NCBI Gene): FZ-8, hFZ8
• Chromosome: 10
• Chromosome location: 10p11.21
• Summary: This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are couple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007255	hsa-miR-375	Luciferase reporter assay	23393589
MIRT007255	hsa-miR-375	Luciferase reporter assay	23396279
MIRT016029	hsa-miR-374b-5p	Sequencing	20371350
MIRT018441	hsa-miR-335-5p	Microarray	18185580
MIRT051873	hsa-let-7c-5p	CLASH	23622248
MIRT668238	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT668237	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT668236	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT668235	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT668234	hsa-miR-548az-5p	HITS-CLIP	23824327
MIRT668233	hsa-miR-548t-5p	HITS-CLIP	23824327
MIRT668231	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT668232	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT668230	hsa-miR-4433a-5p	HITS-CLIP	23824327
MIRT007255	hsa-miR-375	Luciferase reporter assay, Western blotting	32716585
MIRT668238	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT668237	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT668236	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT668235	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT668234	hsa-miR-548az-5p	HITS-CLIP	23824327
MIRT668233	hsa-miR-548t-5p	HITS-CLIP	23824327
MIRT668231	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT668232	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT668230	hsa-miR-4433a-5p	HITS-CLIP	23824327
MIRT1008571	hsa-miR-1261	CLIP-seq
MIRT1008572	hsa-miR-3188	CLIP-seq
MIRT1008573	hsa-miR-3201	CLIP-seq
MIRT1008574	hsa-miR-329	CLIP-seq
MIRT1008575	hsa-miR-362-3p	CLIP-seq
MIRT1008576	hsa-miR-3941	CLIP-seq
MIRT1008577	hsa-miR-4279	CLIP-seq
MIRT1008578	hsa-miR-4286	CLIP-seq
MIRT1008579	hsa-miR-4667-3p	CLIP-seq
MIRT1008580	hsa-miR-4755-3p	CLIP-seq
MIRT1008581	hsa-miR-4791	CLIP-seq
MIRT1008582	hsa-miR-603	CLIP-seq
MIRT1008583	hsa-miR-9	CLIP-seq
MIRT1998821	hsa-miR-2116	CLIP-seq
MIRT1998822	hsa-miR-4651	CLIP-seq
MIRT1998823	hsa-miR-4677-5p	CLIP-seq
MIRT1998824	hsa-miR-5095	CLIP-seq
MIRT1998825	hsa-miR-600	CLIP-seq
MIRT1998826	hsa-miR-608	CLIP-seq
MIRT2232517	hsa-miR-125a-3p	CLIP-seq
MIRT2232518	hsa-miR-150	CLIP-seq
MIRT2232519	hsa-miR-1915	CLIP-seq
MIRT2232520	hsa-miR-3200-5p	CLIP-seq
MIRT2232521	hsa-miR-345	CLIP-seq
MIRT1998822	hsa-miR-4651	CLIP-seq
MIRT1008579	hsa-miR-4667-3p	CLIP-seq
MIRT2232522	hsa-miR-4713-5p	CLIP-seq
MIRT2232523	hsa-miR-4726-3p	CLIP-seq
MIRT2232524	hsa-miR-532-3p	CLIP-seq
MIRT1998826	hsa-miR-608	CLIP-seq
MIRT2388314	hsa-miR-298	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	22682250
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11295046
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030165	Function	PDZ domain binding	IPI	18256285
GO:0030182	Process	Neuron differentiation	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22575959
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0042813	Function	Wnt receptor activity	IBA
GO:0042813	Function	Wnt receptor activity	IDA	28733458
GO:0042813	Function	Wnt receptor activity	IEA
GO:0042813	Function	Wnt receptor activity	TAS	11295046
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	22138402
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:1990851	Component	Wnt-Frizzled-LRP5/6 complex	IEA

Other IDs

• MIM: 606146
• HGNC: 4046
• e!Ensembl: ENSG00000177283

Protein

• UniProt ID: Q9H461
• Protein name: Frizzled-8 (Fz-8) (hFz8)
• Protein function: Receptor for Wnt proteins. Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalosomes. The beta-catenin canonical signaling pathway l
• PDB: 5UN5, 5UN6, 6NDZ, 8X0T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01392	Fz	35 → 143	Fz domain	Domain
  PF01534	Frizzled	268 → 620	Frizzled/Smoothened family membrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Most abundant in fetal kidney, followed by brain and lung. In adult tissues, expressed in kidney, heart, pancreas and skeletal muscle.
• Sequence:

  MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
  TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
  LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
  GHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVS
  VSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFL
  IDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGA
  GAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT
  WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDN
  LRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLY
  TVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
  GVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGPGG
  GGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV

• Sequence length: 694

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Asymmetric localization of PCP proteins
Regulation of FZD by ubiquitination
RNF mutants show enhanced WNT signaling and proliferation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30924074	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26537584	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	26797711		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22138402		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15557753	Associate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	17030514, 21422242		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27276676		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29108281		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	17030514	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32805208	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	17030514, 21422242		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24260260	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22138402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28602974, 29717114, 30051493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11562753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30207869		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31431463		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21931970	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23445611, 27276676		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31040702		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28247840		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28247840	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33618667	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35675627	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	35269556	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28602974, 29717114, 30051493		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29717114	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29441905		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21980461	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29108281		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11562753		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30207869		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30207869		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30207869	Associate	★☆☆☆☆ Found in Text Mining only
Tooth Abnormalities	Tooth abnormalities	Pubtator	39519162	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23445611		★☆☆☆☆ Found in Text Mining only