Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7855
Gene name	Frizzled class receptor 5
Gene symbol	FZD5
Synonyms (NCBI Gene)	C2orf31HFZ5MCOPCB11
Chromosome	2
Chromosome location	2q33.3
Summary	Members of the `frizzled` gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

483 Show/Hide all (483)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030330	hsa-miR-26b-5p	Microarray	19088304
MIRT030625	hsa-miR-24-3p	Sequencing	20371350
MIRT045455	hsa-miR-149-5p	CLASH	23622248
MIRT523606	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT523605	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT523604	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT523603	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT523601	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT523600	hsa-miR-5692b	HITS-CLIP	21572407
MIRT523599	hsa-miR-5692c	HITS-CLIP	21572407
MIRT523598	hsa-miR-300	HITS-CLIP	21572407
MIRT523597	hsa-miR-381-3p	HITS-CLIP	21572407
MIRT523596	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT523595	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT523594	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT523593	hsa-let-7a-3p	HITS-CLIP	21572407
MIRT523592	hsa-let-7b-3p	HITS-CLIP	21572407
MIRT523591	hsa-let-7f-1-3p	HITS-CLIP	21572407
MIRT523590	hsa-miR-98-3p	HITS-CLIP	21572407
MIRT523589	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT523588	hsa-miR-3924	HITS-CLIP	21572407
MIRT570688	hsa-miR-595	PAR-CLIP	20371350
MIRT570687	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT570686	hsa-miR-520h	PAR-CLIP	20371350
MIRT570685	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570684	hsa-miR-548aw	PAR-CLIP	20371350
MIRT570683	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT570682	hsa-miR-527	PAR-CLIP	20371350
MIRT570680	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570681	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT537300	hsa-miR-148a-3p	PAR-CLIP	22012620
MIRT537299	hsa-miR-148b-3p	PAR-CLIP	22012620
MIRT537298	hsa-miR-152-3p	PAR-CLIP	22012620
MIRT537297	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT537296	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT537295	hsa-miR-3611	PAR-CLIP	22012620
MIRT537294	hsa-miR-8055	PAR-CLIP	22012620
MIRT523606	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT523605	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT523604	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT523603	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT523602	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT523601	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523600	hsa-miR-5692b	PAR-CLIP	23446348
MIRT523599	hsa-miR-5692c	PAR-CLIP	23446348
MIRT523598	hsa-miR-300	PAR-CLIP	23446348
MIRT523597	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523596	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT523595	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523594	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT523593	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523592	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523591	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523590	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523589	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523588	hsa-miR-3924	PAR-CLIP	23446348
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT242970	hsa-miR-23a-3p	qRT-PCRMicroarrayWestern blot	25422915
MIRT737082	hsa-miR-934	Luciferase reporter assayWestern blottingqRT-PCR	32459171
MIRT523606	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT523605	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT523604	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT523603	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT523601	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT523600	hsa-miR-5692b	HITS-CLIP	21572407
MIRT523599	hsa-miR-5692c	HITS-CLIP	21572407
MIRT523598	hsa-miR-300	HITS-CLIP	21572407
MIRT523597	hsa-miR-381-3p	HITS-CLIP	21572407
MIRT523596	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT523595	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT523594	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT523593	hsa-let-7a-3p	HITS-CLIP	21572407
MIRT523592	hsa-let-7b-3p	HITS-CLIP	21572407
MIRT523591	hsa-let-7f-1-3p	HITS-CLIP	21572407
MIRT523590	hsa-miR-98-3p	HITS-CLIP	21572407
MIRT523589	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT523588	hsa-miR-3924	HITS-CLIP	21572407
MIRT570688	hsa-miR-595	PAR-CLIP	20371350
MIRT570687	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT570686	hsa-miR-520h	PAR-CLIP	20371350
MIRT570685	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570684	hsa-miR-548aw	PAR-CLIP	20371350
MIRT570683	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT570682	hsa-miR-527	PAR-CLIP	20371350
MIRT570680	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570681	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT537300	hsa-miR-148a-3p	PAR-CLIP	22012620
MIRT537299	hsa-miR-148b-3p	PAR-CLIP	22012620
MIRT537298	hsa-miR-152-3p	PAR-CLIP	22012620
MIRT537297	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT537296	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT537295	hsa-miR-3611	PAR-CLIP	22012620
MIRT537294	hsa-miR-8055	PAR-CLIP	22012620
MIRT523606	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT523605	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT523604	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT523603	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT523602	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT523601	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523600	hsa-miR-5692b	PAR-CLIP	23446348
MIRT523599	hsa-miR-5692c	PAR-CLIP	23446348
MIRT523598	hsa-miR-300	PAR-CLIP	23446348
MIRT523597	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523596	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT523595	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523594	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT523593	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523592	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523591	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523590	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523589	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523588	hsa-miR-3924	PAR-CLIP	23446348
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT030625	hsa-miR-24-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	37575527
MIRT1008332	hsa-let-7a	CLIP-seq
MIRT1008333	hsa-let-7b	CLIP-seq
MIRT1008334	hsa-let-7c	CLIP-seq
MIRT1008335	hsa-let-7d	CLIP-seq
MIRT1008336	hsa-let-7e	CLIP-seq
MIRT1008337	hsa-let-7f	CLIP-seq
MIRT1008338	hsa-let-7g	CLIP-seq
MIRT1008339	hsa-let-7i	CLIP-seq
MIRT1008340	hsa-miR-100	CLIP-seq
MIRT1008341	hsa-miR-1255a	CLIP-seq
MIRT1008342	hsa-miR-1255b	CLIP-seq
MIRT1008343	hsa-miR-1260	CLIP-seq
MIRT1008344	hsa-miR-1260b	CLIP-seq
MIRT1008345	hsa-miR-1827	CLIP-seq
MIRT1008346	hsa-miR-188-3p	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT1008348	hsa-miR-203	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT1008350	hsa-miR-24	CLIP-seq
MIRT1008351	hsa-miR-2467-3p	CLIP-seq
MIRT1008352	hsa-miR-3064-5p	CLIP-seq
MIRT1008353	hsa-miR-3119	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1008355	hsa-miR-3126-5p	CLIP-seq
MIRT1008356	hsa-miR-3130-3p	CLIP-seq
MIRT1008357	hsa-miR-3136-5p	CLIP-seq
MIRT1008358	hsa-miR-3156-3p	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT1008360	hsa-miR-329	CLIP-seq
MIRT1008361	hsa-miR-342-3p	CLIP-seq
MIRT1008362	hsa-miR-3612	CLIP-seq
MIRT1008363	hsa-miR-3617	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1008365	hsa-miR-3622a-3p	CLIP-seq
MIRT1008366	hsa-miR-3622b-3p	CLIP-seq
MIRT1008367	hsa-miR-362-3p	CLIP-seq
MIRT1008368	hsa-miR-3665	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1008370	hsa-miR-374a	CLIP-seq
MIRT1008371	hsa-miR-374b	CLIP-seq
MIRT1008372	hsa-miR-374c	CLIP-seq
MIRT1008373	hsa-miR-383	CLIP-seq
MIRT1008374	hsa-miR-3941	CLIP-seq
MIRT1008375	hsa-miR-3974	CLIP-seq
MIRT1008376	hsa-miR-3976	CLIP-seq
MIRT1008377	hsa-miR-4252	CLIP-seq
MIRT1008378	hsa-miR-4257	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT1008380	hsa-miR-4275	CLIP-seq
MIRT1008381	hsa-miR-4278	CLIP-seq
MIRT1008382	hsa-miR-4282	CLIP-seq
MIRT1008383	hsa-miR-4284	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1008385	hsa-miR-433	CLIP-seq
MIRT1008386	hsa-miR-4417	CLIP-seq
MIRT1008387	hsa-miR-4419a	CLIP-seq
MIRT1008388	hsa-miR-4422	CLIP-seq
MIRT1008389	hsa-miR-4439	CLIP-seq
MIRT1008390	hsa-miR-4458	CLIP-seq
MIRT1008391	hsa-miR-4459	CLIP-seq
MIRT1008392	hsa-miR-4493	CLIP-seq
MIRT1008393	hsa-miR-4500	CLIP-seq
MIRT1008394	hsa-miR-4510	CLIP-seq
MIRT1008395	hsa-miR-4513	CLIP-seq
MIRT1008396	hsa-miR-455-5p	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT1008398	hsa-miR-4649-3p	CLIP-seq
MIRT1008399	hsa-miR-466	CLIP-seq
MIRT1008400	hsa-miR-4660	CLIP-seq
MIRT1008401	hsa-miR-4662a-5p	CLIP-seq
MIRT1008402	hsa-miR-4668-5p	CLIP-seq
MIRT1008403	hsa-miR-4672	CLIP-seq
MIRT1008404	hsa-miR-4684-5p	CLIP-seq
MIRT1008405	hsa-miR-4690-3p	CLIP-seq
MIRT1008406	hsa-miR-4695-5p	CLIP-seq
MIRT1008407	hsa-miR-4698	CLIP-seq
MIRT1008408	hsa-miR-4719	CLIP-seq
MIRT1008409	hsa-miR-4724-3p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT1008411	hsa-miR-4727-5p	CLIP-seq
MIRT1008412	hsa-miR-4747-5p	CLIP-seq
MIRT1008413	hsa-miR-4758-3p	CLIP-seq
MIRT1008414	hsa-miR-4761-5p	CLIP-seq
MIRT1008415	hsa-miR-4762-3p	CLIP-seq
MIRT1008416	hsa-miR-4769-3p	CLIP-seq
MIRT1008417	hsa-miR-4772-5p	CLIP-seq
MIRT1008418	hsa-miR-4797-3p	CLIP-seq
MIRT1008419	hsa-miR-4798-5p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT1008421	hsa-miR-520d-5p	CLIP-seq
MIRT1008422	hsa-miR-524-5p	CLIP-seq
MIRT1008423	hsa-miR-541	CLIP-seq
MIRT1008424	hsa-miR-548a-5p	CLIP-seq
MIRT1008425	hsa-miR-548ab	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008428	hsa-miR-548ak	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT1008430	hsa-miR-548b-5p	CLIP-seq
MIRT1008431	hsa-miR-548c-5p	CLIP-seq
MIRT1008432	hsa-miR-548d-5p	CLIP-seq
MIRT1008433	hsa-miR-548h	CLIP-seq
MIRT1008434	hsa-miR-548i	CLIP-seq
MIRT1008435	hsa-miR-548j	CLIP-seq
MIRT1008436	hsa-miR-548k	CLIP-seq
MIRT1008437	hsa-miR-548l	CLIP-seq
MIRT1008438	hsa-miR-548w	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT1008440	hsa-miR-548y	CLIP-seq
MIRT1008441	hsa-miR-550a	CLIP-seq
MIRT1008442	hsa-miR-559	CLIP-seq
MIRT1008443	hsa-miR-579	CLIP-seq
MIRT1008444	hsa-miR-593	CLIP-seq
MIRT1008445	hsa-miR-603	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT1008447	hsa-miR-641	CLIP-seq
MIRT1008448	hsa-miR-650	CLIP-seq
MIRT1008449	hsa-miR-654-5p	CLIP-seq
MIRT1008450	hsa-miR-655	CLIP-seq
MIRT1008451	hsa-miR-657	CLIP-seq
MIRT1008452	hsa-miR-665	CLIP-seq
MIRT1008453	hsa-miR-7	CLIP-seq
MIRT1008454	hsa-miR-766	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT1008457	hsa-miR-922	CLIP-seq
MIRT1008458	hsa-miR-98	CLIP-seq
MIRT1008459	hsa-miR-99a	CLIP-seq
MIRT1008460	hsa-miR-99b	CLIP-seq
MIRT1998724	hsa-miR-1266	CLIP-seq
MIRT1998725	hsa-miR-1273g	CLIP-seq
MIRT1998726	hsa-miR-1298	CLIP-seq
MIRT1998727	hsa-miR-146a	CLIP-seq
MIRT1998728	hsa-miR-146b-5p	CLIP-seq
MIRT1008345	hsa-miR-1827	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT1008351	hsa-miR-2467-3p	CLIP-seq
MIRT1008352	hsa-miR-3064-5p	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1998729	hsa-miR-3121-3p	CLIP-seq
MIRT1998730	hsa-miR-3125	CLIP-seq
MIRT1008357	hsa-miR-3136-5p	CLIP-seq
MIRT1998731	hsa-miR-3140-3p	CLIP-seq
MIRT1998732	hsa-miR-3155	CLIP-seq
MIRT1998733	hsa-miR-3155b	CLIP-seq
MIRT1998734	hsa-miR-3170	CLIP-seq
MIRT1998735	hsa-miR-3180-5p	CLIP-seq
MIRT1998736	hsa-miR-3187-3p	CLIP-seq
MIRT1998737	hsa-miR-3188	CLIP-seq
MIRT1998738	hsa-miR-3190	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT1998739	hsa-miR-3194-3p	CLIP-seq
MIRT1998740	hsa-miR-3202	CLIP-seq
MIRT1998741	hsa-miR-320e	CLIP-seq
MIRT1998742	hsa-miR-326	CLIP-seq
MIRT1998743	hsa-miR-330-5p	CLIP-seq
MIRT1998744	hsa-miR-34b	CLIP-seq
MIRT1998745	hsa-miR-3609	CLIP-seq
MIRT1008363	hsa-miR-3617	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1998746	hsa-miR-3664-3p	CLIP-seq
MIRT1998747	hsa-miR-3685	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1998748	hsa-miR-384	CLIP-seq
MIRT1998749	hsa-miR-3916	CLIP-seq
MIRT1008378	hsa-miR-4257	CLIP-seq
MIRT1998750	hsa-miR-4261	CLIP-seq
MIRT1998751	hsa-miR-4263	CLIP-seq
MIRT1998752	hsa-miR-4269	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT1008382	hsa-miR-4282	CLIP-seq
MIRT1998753	hsa-miR-4283	CLIP-seq
MIRT1998754	hsa-miR-4301	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1998755	hsa-miR-4418	CLIP-seq
MIRT1998756	hsa-miR-4428	CLIP-seq
MIRT1998757	hsa-miR-4434	CLIP-seq
MIRT1998758	hsa-miR-4438	CLIP-seq
MIRT1008389	hsa-miR-4439	CLIP-seq
MIRT1998759	hsa-miR-4455	CLIP-seq
MIRT1998760	hsa-miR-4489	CLIP-seq
MIRT1998761	hsa-miR-4503	CLIP-seq
MIRT1008395	hsa-miR-4513	CLIP-seq
MIRT1998762	hsa-miR-4514	CLIP-seq
MIRT1998763	hsa-miR-4516	CLIP-seq
MIRT1998764	hsa-miR-4518	CLIP-seq
MIRT1998765	hsa-miR-4519	CLIP-seq
MIRT1998766	hsa-miR-4529-5p	CLIP-seq
MIRT1998767	hsa-miR-4533	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT1998768	hsa-miR-4667-5p	CLIP-seq
MIRT1998769	hsa-miR-4692	CLIP-seq
MIRT1008407	hsa-miR-4698	CLIP-seq
MIRT1998770	hsa-miR-4700-5p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT1008411	hsa-miR-4727-5p	CLIP-seq
MIRT1998771	hsa-miR-4742-5p	CLIP-seq
MIRT1008412	hsa-miR-4747-5p	CLIP-seq
MIRT1998772	hsa-miR-4773	CLIP-seq
MIRT1998773	hsa-miR-4778-3p	CLIP-seq
MIRT1998774	hsa-miR-4778-5p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT1998775	hsa-miR-484	CLIP-seq
MIRT1998776	hsa-miR-498	CLIP-seq
MIRT1998777	hsa-miR-509-3-5p	CLIP-seq
MIRT1998778	hsa-miR-5095	CLIP-seq
MIRT1998779	hsa-miR-509-5p	CLIP-seq
MIRT1998780	hsa-miR-510	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1998781	hsa-miR-548ah	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT1998782	hsa-miR-548g	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT1998783	hsa-miR-576-5p	CLIP-seq
MIRT1998784	hsa-miR-589	CLIP-seq
MIRT1998785	hsa-miR-590-3p	CLIP-seq
MIRT1998786	hsa-miR-605	CLIP-seq
MIRT1998787	hsa-miR-609	CLIP-seq
MIRT1998788	hsa-miR-621	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT1998789	hsa-miR-629	CLIP-seq
MIRT1998790	hsa-miR-637	CLIP-seq
MIRT1008447	hsa-miR-641	CLIP-seq
MIRT1008453	hsa-miR-7	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT1008457	hsa-miR-922	CLIP-seq
MIRT1998791	hsa-miR-924	CLIP-seq
MIRT1998792	hsa-miR-944	CLIP-seq
MIRT2232448	hsa-miR-1185	CLIP-seq
MIRT2232449	hsa-miR-1208	CLIP-seq
MIRT2232450	hsa-miR-1225-5p	CLIP-seq
MIRT2232451	hsa-miR-1226	CLIP-seq
MIRT2232452	hsa-miR-1229	CLIP-seq
MIRT2232453	hsa-miR-1290	CLIP-seq
MIRT2232454	hsa-miR-1299	CLIP-seq
MIRT2232455	hsa-miR-148a	CLIP-seq
MIRT2232456	hsa-miR-148b	CLIP-seq
MIRT2232457	hsa-miR-152	CLIP-seq
MIRT2232458	hsa-miR-1587	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT2232459	hsa-miR-200b	CLIP-seq
MIRT2232460	hsa-miR-200c	CLIP-seq
MIRT2232461	hsa-miR-22	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT2232462	hsa-miR-2355-5p	CLIP-seq
MIRT2232463	hsa-miR-23a	CLIP-seq
MIRT2232464	hsa-miR-23b	CLIP-seq
MIRT2232465	hsa-miR-23c	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1998729	hsa-miR-3121-3p	CLIP-seq
MIRT1998730	hsa-miR-3125	CLIP-seq
MIRT2232466	hsa-miR-3127-3p	CLIP-seq
MIRT1008356	hsa-miR-3130-3p	CLIP-seq
MIRT2232467	hsa-miR-3137	CLIP-seq
MIRT2232468	hsa-miR-3143	CLIP-seq
MIRT2232469	hsa-miR-3160-5p	CLIP-seq
MIRT2232470	hsa-miR-3167	CLIP-seq
MIRT2232471	hsa-miR-3189-3p	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT2232472	hsa-miR-320a	CLIP-seq
MIRT2232473	hsa-miR-320b	CLIP-seq
MIRT2232474	hsa-miR-320c	CLIP-seq
MIRT2232475	hsa-miR-320d	CLIP-seq
MIRT2232476	hsa-miR-330-3p	CLIP-seq
MIRT2232477	hsa-miR-331-3p	CLIP-seq
MIRT2232478	hsa-miR-342-5p	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1008365	hsa-miR-3622a-3p	CLIP-seq
MIRT1008366	hsa-miR-3622b-3p	CLIP-seq
MIRT2232479	hsa-miR-3679-5p	CLIP-seq
MIRT2232480	hsa-miR-3686	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1008372	hsa-miR-374c	CLIP-seq
MIRT1998749	hsa-miR-3916	CLIP-seq
MIRT2232481	hsa-miR-3919	CLIP-seq
MIRT2232482	hsa-miR-3942-3p	CLIP-seq
MIRT1008375	hsa-miR-3974	CLIP-seq
MIRT2232483	hsa-miR-4264	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT2232484	hsa-miR-429	CLIP-seq
MIRT2232485	hsa-miR-4292	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1008385	hsa-miR-433	CLIP-seq
MIRT2232486	hsa-miR-4420	CLIP-seq
MIRT2232487	hsa-miR-4429	CLIP-seq
MIRT2232488	hsa-miR-4432	CLIP-seq
MIRT1998765	hsa-miR-4519	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT2232489	hsa-miR-4651	CLIP-seq
MIRT2232490	hsa-miR-4652-3p	CLIP-seq
MIRT2232491	hsa-miR-4664-5p	CLIP-seq
MIRT2232492	hsa-miR-4674	CLIP-seq
MIRT2232493	hsa-miR-4695-3p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT2232494	hsa-miR-4732-5p	CLIP-seq
MIRT2232495	hsa-miR-4733-3p	CLIP-seq
MIRT2232496	hsa-miR-4756-3p	CLIP-seq
MIRT1008416	hsa-miR-4769-3p	CLIP-seq
MIRT2232497	hsa-miR-4782-5p	CLIP-seq
MIRT2232498	hsa-miR-4796-5p	CLIP-seq
MIRT1008418	hsa-miR-4797-3p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT2232499	hsa-miR-499-5p	CLIP-seq
MIRT2232500	hsa-miR-516b	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT2232501	hsa-miR-548c-3p	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT2232502	hsa-miR-555	CLIP-seq
MIRT2232503	hsa-miR-608	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT2232504	hsa-miR-635	CLIP-seq
MIRT1008450	hsa-miR-655	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT2232505	hsa-miR-876-5p	CLIP-seq
MIRT2232506	hsa-miR-877	CLIP-seq
MIRT2388306	hsa-miR-4723-5p	CLIP-seq
MIRT2388307	hsa-miR-4728-5p	CLIP-seq
MIRT2437333	hsa-miR-125a-5p	CLIP-seq
MIRT2437334	hsa-miR-125b	CLIP-seq
MIRT2437335	hsa-miR-1291	CLIP-seq
MIRT2437336	hsa-miR-3670	CLIP-seq
MIRT2437337	hsa-miR-4319	CLIP-seq
MIRT2437338	hsa-miR-4528	CLIP-seq
MIRT2437333	hsa-miR-125a-5p	CLIP-seq
MIRT2437334	hsa-miR-125b	CLIP-seq
MIRT2437335	hsa-miR-1291	CLIP-seq
MIRT2437336	hsa-miR-3670	CLIP-seq
MIRT2437337	hsa-miR-4319	CLIP-seq
MIRT2437338	hsa-miR-4528	CLIP-seq

83 Show/Hide all (83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000578	Process	Embryonic axis specification	IDA	12121999
GO:0001525	Process	Angiogenesis	IEA
GO:0001540	Function	Amyloid-beta binding	IPI	18234671
GO:0001540	Function	Amyloid-beta binding	TAS	24449494
GO:0001654	Process	Eye development	IMP	26908622
GO:0001944	Process	Vasculature development	IEA
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	16601243
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	18838381, 19643732, 22895187, 26908622, 29748286, 32296183
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15459103, 26908622
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007416	Process	Synapse assembly	TAS	24449494
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008595	Process	Anterior/posterior axis specification, embryo	IDA	9054360
GO:0009986	Component	Cell surface	IDA	19643732
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	26908622
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	12490564, 12857724, 18174455
GO:0017147	Function	Wnt-protein binding	TAS	18234671
GO:0019901	Function	Protein kinase binding	IPI	19643732
GO:0030182	Process	Neuron differentiation	ISS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22575959
GO:0031901	Component	Early endosome membrane	TAS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	16601243
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	26908622
GO:0042813	Function	Wnt receptor activity	IBA
GO:0042813	Function	Wnt receptor activity	IC	9054360
GO:0042813	Function	Wnt receptor activity	IDA	15459103, 26908622, 28733458
GO:0042813	Function	Wnt receptor activity	IEA
GO:0042813	Function	Wnt receptor activity	TAS	24449494
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	18234671
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12857724
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	10906785
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048731	Process	System development	IEA
GO:0060061	Process	Spemann organizer formation	IDA	9054360
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	11029007, 12121999, 12857724, 15459103, 24080158, 26908622, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	9054360
GO:0060561	Process	Apoptotic process involved in morphogenesis	IEA
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0060715	Process	Syncytiotrophoblast cell differentiation involved in labyrinthine layer development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0060718	Process	Chorionic trophoblast cell differentiation	IEA
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	16601243
GO:1901382	Process	Regulation of chorionic trophoblast cell proliferation	IEA
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA

MIM	HGNC	e!Ensembl
601723	4043	ENSG00000163251

Q13467

Protein name

Frizzled-5 (Fz-5) (hFz5) (FzE5)

Protein function

Receptor for Wnt proteins (PubMed:10097073, PubMed:20530549, PubMed:26908622, PubMed:9054360). Functions in the canonical Wnt/beta-catenin signaling pathway. In vitro activates WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 signaling (By similarity)

PDB

5URY , 5URZ , 6O39 , 6WW2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	33 → 141	Fz domain	Domain
PF01534	Frizzled	226 → 537	Frizzled/Smoothened family membrane region	Family

Sequence

MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV

Sequence length

585

Interactions

View interactions

KEGG Pathway	Reactome Pathway
mTOR signaling pathway	Ca2+ pathway
Wnt signaling pathway	Asymmetric localization of PCP proteins
Hippo signaling pathway	Disassembly of the destruction complex and recruitment of AXIN to the membrane
Signaling pathways regulating pluripotency of stem cells	Regulation of FZD by ubiquitination
Melanogenesis	WNT5A-dependent internalization of FZD2, FZD5 and ROR2
Cushing syndrome	RNF mutants show enhanced WNT signaling and proliferation
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital ocular coloboma	Likely pathogenic; Pathogenic	rs2091986259, rs2091987023, rs2091988799	RCV001089479 RCV001089478 RCV001089477	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microphthalmia/coloboma 11	Pathogenic; Likely pathogenic	rs2470339440, rs2470339052, rs750162817, rs2470337831, rs2470337909, rs2091986259	RCV003881723 RCV003881724 RCV003881726 RCV003881727 RCV003881728 RCV003882735 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
BLADDER EXSTROPHY AND EPISPADIAS COMPLEX	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT EYELID	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF CHOROID AND RETINA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF LENS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF OPTIC DISC	—	Disgenet	26908622	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL COLOBOMA OF IRIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FZD5-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (89)
Adenoma	Adenoma	BEFREE	30622113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29533772		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27869803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31534019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20376066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10688908, 11315916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31534019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30841855, 35328735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25209439, 27323393, 27859262, 28215225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25209439, 36001375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15557753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19874621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15557753	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25861751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	31082802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	32737437, 33633439, 36695497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of choroid and retina	Coloboma Of Eye	ORPHANET_DG	26908622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coloboma of lens	Lens coloboma	ORPHANET_DG	26908622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coloboma of optic disc	Coloboma of optic disc	ORPHANET_DG	26908622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	25274627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29021137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30555158, 30689807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37595345	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	ORPHANET_DG	26908622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	26908622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25861751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21937024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31726413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	29477872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	36695497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Exudative Vitreoretinopathy	Exudative Vitreoretinopathy	BEFREE	15981244, 21151595, 21177847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	27188753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	16601243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary macular coloboma	Coloboma of macula	ORPHANET_DG	26908622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	31082802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	22576020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37595345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	15557753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25428027	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30556883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29482174, 30556883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29458020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25209439, 27323393, 27859262, 28215225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28895566, 29930766, 30051493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30622113, 31431458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17545618, 19956716, 22182510, 22606268, 25313882, 27815069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25274627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21937024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	28111184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	36695497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	24755605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	33633439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31726413		★★★★★ ★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	BEFREE	22211385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	BEFREE	22211385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	31082802	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27373314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21472018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19421142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15705594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31534019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10688908	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15087387, 17318900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17318900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33723319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33618667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	22576020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	27818488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28895566, 29930766, 30051493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34697900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19399181, 26202350, 29441905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27188753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25861751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21151595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31735061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	26998835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19543744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30622113, 31431458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17273778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30624523, 33618713, 35848483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11315916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11315916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21898546, 27859262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17939044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34562599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	9147651		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SALL2	4	["Cleft eyelid","Coloboma","Congenital iris coloboma","Congenital ocular coloboma"]	0	[]	4	["Disgenet (Cleft eyelid)","Disgenet (Coloboma)","Disgenet (Congenital iris coloboma)","Disgenet (Congenital ocular coloboma)"]
ABCB6	4	["Cleft eyelid","Coloboma","Congenital iris coloboma","Microphthalmia"]	0	[]	7	["Disgenet (Cleft eyelid)","Disgenet (Coloboma)","Disgenet (Congenital iris coloboma)","Disgenet (Microphthalmia)","ClinVar (Microphthalmia)","GWAS catalog (Microphthalmia)","HPO (Microphthalmia)"]
FZD2	0	[]	15	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","Disassembly of the destruction complex and recruitment of AXIN to the membrane"]	0	[]
FZD8	0	[]	14	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","Asymmetric localization of PCP proteins"]	0	[]
FZD6	0	[]	14	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","Ca2+ pathway"]	0	[]

FZD5 (frizzled class receptor 5)

Bookmark This Gene