Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11211
Gene name	Frizzled class receptor 10
Gene symbol	FZD10
Synonyms (NCBI Gene)	CD350FZ-10Fz10FzE7hFz10
Chromosome	12
Chromosome location	12q24.33
Summary	This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-c

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017968	hsa-miR-335-5p	Microarray	18185580
MIRT027638	hsa-miR-98-5p	Microarray	19088304
MIRT658043	hsa-miR-548aa	HITS-CLIP	23824327
MIRT658042	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT658041	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT658040	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT658043	hsa-miR-548aa	HITS-CLIP	23824327
MIRT658042	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT658041	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT658040	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT1007772	hsa-miR-4276	CLIP-seq
MIRT1007773	hsa-miR-4302	CLIP-seq
MIRT1549086	hsa-miR-2467-3p	CLIP-seq
MIRT1549087	hsa-miR-3120-5p	CLIP-seq
MIRT1549088	hsa-miR-3134	CLIP-seq
MIRT1549089	hsa-miR-3678-3p	CLIP-seq
MIRT1549090	hsa-miR-3689d	CLIP-seq
MIRT1549091	hsa-miR-431	CLIP-seq
MIRT1549092	hsa-miR-4534	CLIP-seq
MIRT1549093	hsa-miR-4652-3p	CLIP-seq
MIRT1549094	hsa-miR-4802-5p	CLIP-seq
MIRT1998556	hsa-miR-587	CLIP-seq
MIRT1998557	hsa-miR-885-5p	CLIP-seq
MIRT2232324	hsa-miR-330-3p	CLIP-seq
MIRT2232325	hsa-miR-3909	CLIP-seq
MIRT2232326	hsa-miR-518a-5p	CLIP-seq
MIRT2232327	hsa-miR-527	CLIP-seq

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15930302, 19188438, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16007199
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10448064
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IDA	18271942
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	19137009
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IMP	19137009
GO:0042813	Function	Wnt receptor activity	IDA	28733458
GO:0042813	Function	Wnt receptor activity	TAS	10448064
GO:0046330	Process	Positive regulation of JNK cascade	IMP	19137009
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0071300	Process	Cellular response to retinoic acid	ISS

MIM	HGNC	e!Ensembl
606147	4039	ENSG00000111432

Q9ULW2

Protein name

Frizzled-10 (Fz-10) (hFz10) (FzE7) (CD antigen CD350)

Protein function

Receptor for Wnt proteins. Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumu

PDB

7X8Q , 7X8T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	34 → 142	Fz domain	Domain
PF01534	Frizzled	218 → 538	Frizzled/Smoothened family membrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Highest levels in the placenta and fetal kidney, followed by fetal lung and brain. In adult brain, abundantly expressed in the cerebellum, followed by cerebral cortex, medulla and spinal cord; very low levels in total brain, frontal lo

Sequence

MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV

Sequence length

581

Interactions

View interactions

KEGG Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC DISEASE	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
Adenoma of large intestine	Colorectal adenoma	BEFREE	31336886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32933173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36764493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33804101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18057535, 33485313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30967398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10448064, 11786918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31836665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11786918, 19134005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19134005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19134005, 32933173, 34059508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28678406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11786918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33857857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11786918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32764209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30286088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31275379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11786918, 29416658, 31275379, 31349740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10448064, 11786918		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29416658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22780124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32138771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16007199, 19134005, 29416658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28641578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26571495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31275379		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16007199, 16556060, 19137009, 26571495, 29884132, 29952132		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	19137009		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
FZD9	[]	11	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer"]	[]
WNT2	[]	11	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer"]	[]
WNT6	[]	11	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer"]	[]
WNT7A	[]	11	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer"]	[]
WNT7B	[]	11	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer"]	[]

FZD10 (frizzled class receptor 10)

Bookmark This Gene