Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3446
Gene name	Interferon alpha 10
Gene symbol	IFNA10
Synonyms (NCBI Gene)	IFN-alphaC
Chromosome	9
Chromosome location	9p21.3
Summary	This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

MIM	HGNC	e!Ensembl
147577	5418	ENSG00000186803

P01566

Protein name

Interferon alpha-10 (IFN-alpha-10) (Interferon alpha-6L) (Interferon alpha-C) (LeIF C)

Protein function

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD

Sequence length

189

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Interferon alpha/beta signaling
PI3K-Akt signaling pathway	Regulation of IFNA signaling
Necroptosis	TRAF6 mediated IRF7 activation
Toll-like receptor signaling pathway	Factors involved in megakaryocyte development and platelet production
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
JAK-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Alcoholic liver disease
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Autoimmune thyroid disease
Lipid and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Susceptibility to severe COVID-19	Likely risk allele	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Crohn Disease	Crohn Disease	BEFREE	26000985	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11555602	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	20722470	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
IFNA1	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	[]
IFNA2	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	[]
IFNA4	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	[]
IFNA5	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	[]
IFNA6	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	[]

IFNA10 (interferon alpha 10)

Bookmark This Gene