IFNA7 (interferon alpha 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3444
Gene name Interferon alpha 7
Gene symbol IFNA7
Synonyms (NCBI Gene)
IFN-alphaJIFNA-J
Chromosome 9
Chromosome location 9p21.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2549839 hsa-miR-1272 CLIP-seq
MIRT2549840 hsa-miR-580 CLIP-seq
MIRT2549841 hsa-miR-587 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IBA
GO:0002286 Process T cell activation involved in immune response IBA
GO:0002312 Process B cell activation involved in immune response IBA
GO:0002323 Process Natural killer cell activation involved in immune response IBA
GO:0005125 Function Cytokine activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
147567 5428 ENSG00000214042
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01567
Protein name Interferon alpha-7 (IFN-alpha-7) (Interferon alpha-J) (LeIF J) (Interferon alpha-J1) (IFN-alpha-J1)
Protein function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00143 Interferon 26 → 185 Interferon alpha/beta domain Domain
Sequence 
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFR
FPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTN
LKKGLRRKD
Sequence length 189
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Cytokine-cytokine receptor interaction Interferon alpha/beta signaling
PI3K-Akt signaling pathway Regulation of IFNA signaling
Necroptosis TRAF6 mediated IRF7 activation
Toll-like receptor signaling pathway Factors involved in megakaryocyte development and platelet production
NOD-like receptor signaling pathway  
RIG-I-like receptor signaling pathway  
Cytosolic DNA-sensing pathway  
JAK-STAT signaling pathway  
Natural killer cell mediated cytotoxicity  
Alcoholic liver disease  
Tuberculosis  
Hepatitis C  
Hepatitis B  
Measles  
Human cytomegalovirus infection  
Influenza A  
Human papillomavirus infection  
Kaposi sarcoma-associated herpesvirus infection  
Herpes simplex virus 1 infection  
Epstein-Barr virus infection  
Human immunodeficiency virus 1 infection  
Coronavirus disease - COVID-19  
Pathways in cancer  
Autoimmune thyroid disease  
Lipid and atherosclerosis  
Sort by:
IFNA1 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA2 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA4 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA5 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA6 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis.
Melanoma Linked via 3 of 5 related genesIFNA1, IFNA2, IFNA5 Pancreatic neoplasms Linked via 3 of 5 related genesIFNA1, IFNA2, IFNA5 Colorectal neoplasms Linked via 2 of 5 related genesIFNA1, IFNA2 T-cell leukemia-lymphoma Linked via 2 of 5 related genesIFNA1, IFNA2 Liver cirrhosis Linked via 2 of 5 related genesIFNA1, IFNA2