CTSE (cathepsin E)

Gene

• Entrez ID: 1510
• Gene name: Cathepsin E
• Gene symbol: CTSE
• Synonyms (NCBI Gene): CATE
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: This gene encodes a member of the A1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature enzyme. T

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050230	hsa-miR-25-3p	CLASH	23622248
MIRT550946	hsa-miR-595	PAR-CLIP	20371350
MIRT550945	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT569479	hsa-miR-3650	PAR-CLIP	20371350
MIRT569478	hsa-miR-567	PAR-CLIP	20371350
MIRT550944	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT550940	hsa-miR-573	PAR-CLIP	20371350
MIRT569477	hsa-miR-297	PAR-CLIP	20371350
MIRT550939	hsa-miR-3611	PAR-CLIP	20371350
MIRT569476	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT550938	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT550946	hsa-miR-595	PAR-CLIP	21572407
MIRT550945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT550944	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT550940	hsa-miR-573	PAR-CLIP	21572407
MIRT550939	hsa-miR-3611	PAR-CLIP	21572407
MIRT550938	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT550946	hsa-miR-595	PAR-CLIP	20371350
MIRT550945	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT569479	hsa-miR-3650	PAR-CLIP	20371350
MIRT569478	hsa-miR-567	PAR-CLIP	20371350
MIRT550944	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT550940	hsa-miR-573	PAR-CLIP	20371350
MIRT569477	hsa-miR-297	PAR-CLIP	20371350
MIRT550939	hsa-miR-3611	PAR-CLIP	20371350
MIRT569476	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT550938	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT550946	hsa-miR-595	PAR-CLIP	21572407
MIRT550945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT550944	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT550940	hsa-miR-573	PAR-CLIP	21572407
MIRT550939	hsa-miR-3611	PAR-CLIP	21572407
MIRT550938	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT915904	hsa-miR-129-5p	CLIP-seq
MIRT915905	hsa-miR-3064-3p	CLIP-seq
MIRT915906	hsa-miR-3143	CLIP-seq
MIRT915907	hsa-miR-3145-5p	CLIP-seq
MIRT915908	hsa-miR-3647-5p	CLIP-seq
MIRT915909	hsa-miR-3669	CLIP-seq
MIRT915910	hsa-miR-3977	CLIP-seq
MIRT915911	hsa-miR-4274	CLIP-seq
MIRT915912	hsa-miR-4476	CLIP-seq
MIRT915913	hsa-miR-4511	CLIP-seq
MIRT915914	hsa-miR-4530	CLIP-seq
MIRT915915	hsa-miR-4691-5p	CLIP-seq
MIRT915916	hsa-miR-4715-3p	CLIP-seq
MIRT915917	hsa-miR-4776-3p	CLIP-seq
MIRT915918	hsa-miR-543	CLIP-seq
MIRT915919	hsa-miR-640	CLIP-seq
MIRT915909	hsa-miR-3669	CLIP-seq
MIRT915910	hsa-miR-3977	CLIP-seq
MIRT1971624	hsa-miR-423-3p	CLIP-seq
MIRT2510454	hsa-miR-105	CLIP-seq
MIRT2510455	hsa-miR-3171	CLIP-seq
MIRT2510456	hsa-miR-3647-3p	CLIP-seq
MIRT2510457	hsa-miR-3662	CLIP-seq
MIRT2510458	hsa-miR-4282	CLIP-seq
MIRT2510459	hsa-miR-4698	CLIP-seq
MIRT2510454	hsa-miR-105	CLIP-seq
MIRT2510455	hsa-miR-3171	CLIP-seq
MIRT2510456	hsa-miR-3647-3p	CLIP-seq
MIRT2510457	hsa-miR-3662	CLIP-seq
MIRT2510458	hsa-miR-4282	CLIP-seq
MIRT2510459	hsa-miR-4698	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004190	Function	Aspartic-type endopeptidase activity	IBA
GO:0004190	Function	Aspartic-type endopeptidase activity	IDA	7789521
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	7983070
GO:0005768	Component	Endosome	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	16997486
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	16997486
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	8765029
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0042802	Function	Identical protein binding	IEA

Other IDs

• MIM: 116890
• HGNC: 2530
• e!Ensembl: ENSG00000196188

Protein

• UniProt ID: P14091
• Protein name: Cathepsin E (EC 3.4.23.34) [Cleaved into: Cathepsin E form I; Cathepsin E form II]
• Protein function: May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degenerati
• PDB: 1TZS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07966	A1_Propeptide	21 → 49	A1 Propeptide	Motif
  PF00026	Asp	77 → 394	Eukaryotic aspartyl protease	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes. {ECO:0000269|PubMed:11322887, ECO:0000269|PubMed
• Sequence:

  MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
  SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
  QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAE
  FDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSH
  FSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNA
  IGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDI
  HPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

• Sequence length: 396

Pathways

KEGG:

Lysosome

Reactome:

MHC class II antigen presentation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15221939, 25348778		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25348778		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30317601		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19172291, 23451082		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28583160		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	28583160		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22068166, 25184278, 28582716, 31582345		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	25348778		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25348778	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	34741638	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23451082	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17888866		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29051346	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39471066	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25239563		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25348778		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	14769879		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	14769879		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	14769879		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	25348778		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28298913		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25348778	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17888866		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30816218		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31582345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20482316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23451082		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17888866, 25348778, 28424202		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25348778		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	24464956		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31095099		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15138631		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15958626, 20482316, 23451082, 25184278, 31582345		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31582345		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	28424202, 31582345		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	31582345		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31582345		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12000726, 32537471, 33815409, 38267509	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20482316		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26488201	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	25239563		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	28583160		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	14769879		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23451082		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23451082	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1370478, 23451082, 25348778, 2674141	Associate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	15958626		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33048468, 37325625, 40481075	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	9094979	Associate	★☆☆☆☆ Found in Text Mining only