PSME3 (proteasome activator subunit 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10197
• Gene name: Proteasome activator subunit 3
• Gene symbol: PSME3
• Synonyms (NCBI Gene): HEL-S-283, Ki, PA28-gamma, PA28G, PA28gamma, REG-GAMMA
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA Show/Hide all (881)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004063	hsa-miR-7-5p	Microarray	19073608
MIRT020956	hsa-miR-155-5p	Proteomics	18668040
MIRT022991	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT004063	hsa-miR-7-5p	Microarray;Other	19073608
MIRT030577	hsa-miR-24-3p	Microarray	19748357
MIRT031898	hsa-miR-16-5p	Proteomics	18668040
MIRT032477	hsa-let-7b-5p	Proteomics	18668040
MIRT032477	hsa-let-7b-5p	CLASH	23622248
MIRT031898	hsa-miR-16-5p	CLASH	23622248
MIRT043475	hsa-miR-331-3p	CLASH	23622248
MIRT043211	hsa-miR-324-5p	CLASH	23622248
MIRT043211	hsa-miR-324-5p	CLASH	23622248
MIRT042151	hsa-miR-484	CLASH	23622248
MIRT004063	hsa-miR-7-5p	GFP reporter assay	23762407
MIRT004063	hsa-miR-7-5p	FACS, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24281414
MIRT004063	hsa-miR-7-5p	FACS, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24281414
MIRT004063	hsa-miR-7-5p	FACS, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24281414
MIRT004063	hsa-miR-7-5p	FACS, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24281414
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT724088	hsa-miR-34c-3p	HITS-CLIP	19536157
MIRT251100	hsa-miR-548au-3p	HITS-CLIP	19536157
MIRT724087	hsa-miR-503-3p	HITS-CLIP	19536157
MIRT724086	hsa-miR-1206	HITS-CLIP	19536157
MIRT724085	hsa-miR-425-3p	HITS-CLIP	19536157
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT287291	hsa-miR-4311	PAR-CLIP	20371350
MIRT564120	hsa-miR-1276	PAR-CLIP	20371350
MIRT077242	hsa-miR-583	PAR-CLIP	20371350
MIRT564119	hsa-miR-5692a	PAR-CLIP	20371350
MIRT564118	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT287289	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT287286	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT470161	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT375623	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT375624	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT470160	hsa-miR-4779	PAR-CLIP	23592263
MIRT470159	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT470158	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470157	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470156	hsa-miR-4459	PAR-CLIP	23592263
MIRT470155	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470154	hsa-miR-4419a	PAR-CLIP	23592263
MIRT470153	hsa-miR-4510	PAR-CLIP	23592263
MIRT470152	hsa-miR-6127	PAR-CLIP	23592263
MIRT470151	hsa-miR-6129	PAR-CLIP	23592263
MIRT470150	hsa-miR-6130	PAR-CLIP	23592263
MIRT470149	hsa-miR-6133	PAR-CLIP	23592263
MIRT470148	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT470147	hsa-miR-4306	PAR-CLIP	23592263
MIRT470146	hsa-miR-4644	PAR-CLIP	23592263
MIRT470145	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470144	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470143	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT470142	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470141	hsa-miR-8085	PAR-CLIP	23592263
MIRT470140	hsa-miR-3175	PAR-CLIP	23592263
MIRT470138	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470139	hsa-miR-5698	PAR-CLIP	23592263
MIRT470137	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470136	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470135	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT726847	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726846	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726845	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT043211	hsa-miR-324-5p	PAR-CLIP	26701625
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT724088	hsa-miR-34c-3p	HITS-CLIP	19536157
MIRT251100	hsa-miR-548au-3p	HITS-CLIP	19536157
MIRT724087	hsa-miR-503-3p	HITS-CLIP	19536157
MIRT724086	hsa-miR-1206	HITS-CLIP	19536157
MIRT724085	hsa-miR-425-3p	HITS-CLIP	19536157
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT287291	hsa-miR-4311	PAR-CLIP	20371350
MIRT564120	hsa-miR-1276	PAR-CLIP	20371350
MIRT077242	hsa-miR-583	PAR-CLIP	20371350
MIRT564119	hsa-miR-5692a	PAR-CLIP	20371350
MIRT564118	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT287289	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT287286	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT470161	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT375623	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT375624	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT470160	hsa-miR-4779	PAR-CLIP	23592263
MIRT470159	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT470158	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470157	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470156	hsa-miR-4459	PAR-CLIP	23592263
MIRT470155	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470154	hsa-miR-4419a	PAR-CLIP	23592263
MIRT470153	hsa-miR-4510	PAR-CLIP	23592263
MIRT470152	hsa-miR-6127	PAR-CLIP	23592263
MIRT470151	hsa-miR-6129	PAR-CLIP	23592263
MIRT470150	hsa-miR-6130	PAR-CLIP	23592263
MIRT470149	hsa-miR-6133	PAR-CLIP	23592263
MIRT470148	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT470147	hsa-miR-4306	PAR-CLIP	23592263
MIRT470146	hsa-miR-4644	PAR-CLIP	23592263
MIRT470145	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470144	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470143	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT470142	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470141	hsa-miR-8085	PAR-CLIP	23592263
MIRT470140	hsa-miR-3175	PAR-CLIP	23592263
MIRT470138	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470139	hsa-miR-5698	PAR-CLIP	23592263
MIRT470137	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470136	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470135	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT1270752	hsa-miR-1178	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT1270755	hsa-miR-1226	CLIP-seq
MIRT1270756	hsa-miR-1262	CLIP-seq
MIRT1270757	hsa-miR-1275	CLIP-seq
MIRT1270758	hsa-miR-1293	CLIP-seq
MIRT1270759	hsa-miR-1299	CLIP-seq
MIRT1270760	hsa-miR-132	CLIP-seq
MIRT1270761	hsa-miR-1321	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT1270763	hsa-miR-186	CLIP-seq
MIRT1270764	hsa-miR-191	CLIP-seq
MIRT1270765	hsa-miR-1911	CLIP-seq
MIRT1270766	hsa-miR-199a-3p	CLIP-seq
MIRT1270767	hsa-miR-199b-3p	CLIP-seq
MIRT1270768	hsa-miR-212	CLIP-seq
MIRT1270769	hsa-miR-224	CLIP-seq
MIRT1270770	hsa-miR-2682	CLIP-seq
MIRT1270771	hsa-miR-298	CLIP-seq
MIRT1270772	hsa-miR-3065-5p	CLIP-seq
MIRT1270773	hsa-miR-3129-3p	CLIP-seq
MIRT1270774	hsa-miR-3129-5p	CLIP-seq
MIRT1270775	hsa-miR-3136-5p	CLIP-seq
MIRT1270776	hsa-miR-3150b-3p	CLIP-seq
MIRT1270777	hsa-miR-3179	CLIP-seq
MIRT1270778	hsa-miR-3183	CLIP-seq
MIRT1270779	hsa-miR-3184	CLIP-seq
MIRT1270780	hsa-miR-3189-5p	CLIP-seq
MIRT1270781	hsa-miR-3200-3p	CLIP-seq
MIRT1270782	hsa-miR-3202	CLIP-seq
MIRT1270783	hsa-miR-323-3p	CLIP-seq
MIRT1270784	hsa-miR-326	CLIP-seq
MIRT1270785	hsa-miR-329	CLIP-seq
MIRT1270786	hsa-miR-330-5p	CLIP-seq
MIRT1270787	hsa-miR-345	CLIP-seq
MIRT1270788	hsa-miR-34a	CLIP-seq
MIRT1270789	hsa-miR-34c-5p	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT1270791	hsa-miR-3612	CLIP-seq
MIRT1270792	hsa-miR-362-3p	CLIP-seq
MIRT1270793	hsa-miR-3646	CLIP-seq
MIRT1270794	hsa-miR-365	CLIP-seq
MIRT1270795	hsa-miR-3655	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT1270797	hsa-miR-3675-3p	CLIP-seq
MIRT1270798	hsa-miR-3677-3p	CLIP-seq
MIRT1270799	hsa-miR-3689a-5p	CLIP-seq
MIRT1270800	hsa-miR-3689b	CLIP-seq
MIRT1270801	hsa-miR-3689e	CLIP-seq
MIRT1270802	hsa-miR-3689f	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270806	hsa-miR-3941	CLIP-seq
MIRT1270807	hsa-miR-3973	CLIP-seq
MIRT1270808	hsa-miR-423-5p	CLIP-seq
MIRT1270809	hsa-miR-4251	CLIP-seq
MIRT1270810	hsa-miR-4271	CLIP-seq
MIRT1270811	hsa-miR-4294	CLIP-seq
MIRT1270812	hsa-miR-4318	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT1270815	hsa-miR-4439	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT1270817	hsa-miR-4469	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270819	hsa-miR-4483	CLIP-seq
MIRT1270820	hsa-miR-4493	CLIP-seq
MIRT1270821	hsa-miR-449a	CLIP-seq
MIRT1270822	hsa-miR-449b	CLIP-seq
MIRT1270823	hsa-miR-449c	CLIP-seq
MIRT1270824	hsa-miR-4501	CLIP-seq
MIRT1270825	hsa-miR-4504	CLIP-seq
MIRT1270826	hsa-miR-4513	CLIP-seq
MIRT1270827	hsa-miR-4533	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT1270829	hsa-miR-455-3p	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT1270831	hsa-miR-4648	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT1270833	hsa-miR-4654	CLIP-seq
MIRT1270834	hsa-miR-466	CLIP-seq
MIRT1270835	hsa-miR-4661-3p	CLIP-seq
MIRT1270836	hsa-miR-4665-5p	CLIP-seq
MIRT1270837	hsa-miR-4672	CLIP-seq
MIRT1270838	hsa-miR-4678	CLIP-seq
MIRT1270839	hsa-miR-4681	CLIP-seq
MIRT1270840	hsa-miR-4685-5p	CLIP-seq
MIRT1270841	hsa-miR-4688	CLIP-seq
MIRT1270842	hsa-miR-4689	CLIP-seq
MIRT1270843	hsa-miR-4695-5p	CLIP-seq
MIRT1270844	hsa-miR-4696	CLIP-seq
MIRT1270845	hsa-miR-4699-5p	CLIP-seq
MIRT1270846	hsa-miR-4701-3p	CLIP-seq
MIRT1270847	hsa-miR-4707-5p	CLIP-seq
MIRT1270848	hsa-miR-4710	CLIP-seq
MIRT1270849	hsa-miR-4717-3p	CLIP-seq
MIRT1270850	hsa-miR-4719	CLIP-seq
MIRT1270851	hsa-miR-4723-3p	CLIP-seq
MIRT1270852	hsa-miR-4725-3p	CLIP-seq
MIRT1270853	hsa-miR-4728-5p	CLIP-seq
MIRT1270854	hsa-miR-4733-3p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270856	hsa-miR-4738-3p	CLIP-seq
MIRT1270857	hsa-miR-4739	CLIP-seq
MIRT1270858	hsa-miR-4742-3p	CLIP-seq
MIRT1270859	hsa-miR-4747-5p	CLIP-seq
MIRT1270860	hsa-miR-4752	CLIP-seq
MIRT1270861	hsa-miR-4756-5p	CLIP-seq
MIRT1270862	hsa-miR-4758-3p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT1270864	hsa-miR-4769-5p	CLIP-seq
MIRT1270865	hsa-miR-4783-3p	CLIP-seq
MIRT1270866	hsa-miR-4784	CLIP-seq
MIRT1270867	hsa-miR-4789-3p	CLIP-seq
MIRT1270868	hsa-miR-4793-5p	CLIP-seq
MIRT1270869	hsa-miR-4795-3p	CLIP-seq
MIRT1270870	hsa-miR-4796-3p	CLIP-seq
MIRT1270871	hsa-miR-4797-3p	CLIP-seq
MIRT1270872	hsa-miR-4802-3p	CLIP-seq
MIRT1270873	hsa-miR-4802-5p	CLIP-seq
MIRT1270874	hsa-miR-4803	CLIP-seq
MIRT1270875	hsa-miR-486-3p	CLIP-seq
MIRT1270876	hsa-miR-489	CLIP-seq
MIRT1270877	hsa-miR-495	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270880	hsa-miR-516b	CLIP-seq
MIRT1270881	hsa-miR-518a-3p	CLIP-seq
MIRT1270882	hsa-miR-518b	CLIP-seq
MIRT1270883	hsa-miR-518c	CLIP-seq
MIRT1270884	hsa-miR-518d-3p	CLIP-seq
MIRT1270885	hsa-miR-518f	CLIP-seq
MIRT1270886	hsa-miR-520g	CLIP-seq
MIRT1270887	hsa-miR-520h	CLIP-seq
MIRT1270888	hsa-miR-539	CLIP-seq
MIRT1270889	hsa-miR-542-3p	CLIP-seq
MIRT1270890	hsa-miR-548ag	CLIP-seq
MIRT1270891	hsa-miR-548ai	CLIP-seq
MIRT1270892	hsa-miR-548k	CLIP-seq
MIRT1270893	hsa-miR-548m	CLIP-seq
MIRT1270894	hsa-miR-567	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT1270896	hsa-miR-578	CLIP-seq
MIRT1270897	hsa-miR-590-3p	CLIP-seq
MIRT1270898	hsa-miR-603	CLIP-seq
MIRT1270899	hsa-miR-625	CLIP-seq
MIRT1270900	hsa-miR-642a	CLIP-seq
MIRT1270901	hsa-miR-650	CLIP-seq
MIRT1270902	hsa-miR-654-3p	CLIP-seq
MIRT1270903	hsa-miR-656	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT1270905	hsa-miR-671-5p	CLIP-seq
MIRT1270906	hsa-miR-7	CLIP-seq
MIRT1270907	hsa-miR-765	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT1270909	hsa-miR-875-3p	CLIP-seq
MIRT1270910	hsa-miR-936	CLIP-seq
MIRT1270911	hsa-miR-940	CLIP-seq
MIRT1270912	hsa-miR-944	CLIP-seq
MIRT1270752	hsa-miR-1178	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT1270756	hsa-miR-1262	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT1270764	hsa-miR-191	CLIP-seq
MIRT1270766	hsa-miR-199a-3p	CLIP-seq
MIRT1270767	hsa-miR-199b-3p	CLIP-seq
MIRT1270769	hsa-miR-224	CLIP-seq
MIRT1270770	hsa-miR-2682	CLIP-seq
MIRT1270774	hsa-miR-3129-5p	CLIP-seq
MIRT1270776	hsa-miR-3150b-3p	CLIP-seq
MIRT1270778	hsa-miR-3183	CLIP-seq
MIRT1270781	hsa-miR-3200-3p	CLIP-seq
MIRT1270783	hsa-miR-323-3p	CLIP-seq
MIRT1270793	hsa-miR-3646	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT1270817	hsa-miR-4469	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270913	hsa-miR-4494	CLIP-seq
MIRT1270914	hsa-miR-4499	CLIP-seq
MIRT1270823	hsa-miR-449c	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT1270834	hsa-miR-466	CLIP-seq
MIRT1270842	hsa-miR-4689	CLIP-seq
MIRT1270844	hsa-miR-4696	CLIP-seq
MIRT1270846	hsa-miR-4701-3p	CLIP-seq
MIRT1270847	hsa-miR-4707-5p	CLIP-seq
MIRT1270848	hsa-miR-4710	CLIP-seq
MIRT1270850	hsa-miR-4719	CLIP-seq
MIRT1270851	hsa-miR-4723-3p	CLIP-seq
MIRT1270915	hsa-miR-4724-5p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270916	hsa-miR-4760-3p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT1270865	hsa-miR-4783-3p	CLIP-seq
MIRT1270866	hsa-miR-4784	CLIP-seq
MIRT1270867	hsa-miR-4789-3p	CLIP-seq
MIRT1270871	hsa-miR-4797-3p	CLIP-seq
MIRT1270874	hsa-miR-4803	CLIP-seq
MIRT1270917	hsa-miR-499a-5p	CLIP-seq
MIRT1270881	hsa-miR-518a-3p	CLIP-seq
MIRT1270882	hsa-miR-518b	CLIP-seq
MIRT1270883	hsa-miR-518c	CLIP-seq
MIRT1270884	hsa-miR-518d-3p	CLIP-seq
MIRT1270885	hsa-miR-518f	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT1270900	hsa-miR-642a	CLIP-seq
MIRT1270910	hsa-miR-936	CLIP-seq
MIRT1270911	hsa-miR-940	CLIP-seq
MIRT1270761	hsa-miR-1321	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT1552662	hsa-miR-3162-5p	CLIP-seq
MIRT1552663	hsa-miR-3714	CLIP-seq
MIRT1270857	hsa-miR-4739	CLIP-seq
MIRT1270858	hsa-miR-4742-3p	CLIP-seq
MIRT1270859	hsa-miR-4747-5p	CLIP-seq
MIRT1270861	hsa-miR-4756-5p	CLIP-seq
MIRT2079602	hsa-miR-103a	CLIP-seq
MIRT2079603	hsa-miR-107	CLIP-seq
MIRT2079604	hsa-miR-1200	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT1270755	hsa-miR-1226	CLIP-seq
MIRT2079605	hsa-miR-1252	CLIP-seq
MIRT1270756	hsa-miR-1262	CLIP-seq
MIRT1270758	hsa-miR-1293	CLIP-seq
MIRT1270760	hsa-miR-132	CLIP-seq
MIRT2079606	hsa-miR-15a	CLIP-seq
MIRT2079607	hsa-miR-15b	CLIP-seq
MIRT2079608	hsa-miR-16	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT2079609	hsa-miR-193a-3p	CLIP-seq
MIRT2079610	hsa-miR-193b	CLIP-seq
MIRT2079611	hsa-miR-195	CLIP-seq
MIRT2079612	hsa-miR-2052	CLIP-seq
MIRT2079613	hsa-miR-2113	CLIP-seq
MIRT1270768	hsa-miR-212	CLIP-seq
MIRT1270769	hsa-miR-224	CLIP-seq
MIRT2079614	hsa-miR-2355-5p	CLIP-seq
MIRT2079615	hsa-miR-28-5p	CLIP-seq
MIRT1270771	hsa-miR-298	CLIP-seq
MIRT2079616	hsa-miR-3064-5p	CLIP-seq
MIRT1270772	hsa-miR-3065-5p	CLIP-seq
MIRT2079617	hsa-miR-30a	CLIP-seq
MIRT2079618	hsa-miR-30b	CLIP-seq
MIRT2079619	hsa-miR-30c	CLIP-seq
MIRT2079620	hsa-miR-30d	CLIP-seq
MIRT2079621	hsa-miR-30e	CLIP-seq
MIRT2079622	hsa-miR-3125	CLIP-seq
MIRT2079623	hsa-miR-3139	CLIP-seq
MIRT2079624	hsa-miR-3151	CLIP-seq
MIRT2079625	hsa-miR-3153	CLIP-seq
MIRT1270777	hsa-miR-3179	CLIP-seq
MIRT1270780	hsa-miR-3189-5p	CLIP-seq
MIRT2079626	hsa-miR-342-3p	CLIP-seq
MIRT1270788	hsa-miR-34a	CLIP-seq
MIRT1270789	hsa-miR-34c-5p	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT2079627	hsa-miR-3607-5p	CLIP-seq
MIRT1270794	hsa-miR-365	CLIP-seq
MIRT2079628	hsa-miR-3652	CLIP-seq
MIRT1270795	hsa-miR-3655	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT2079629	hsa-miR-3669	CLIP-seq
MIRT2079630	hsa-miR-3678-3p	CLIP-seq
MIRT2079631	hsa-miR-3679-3p	CLIP-seq
MIRT2079632	hsa-miR-3692	CLIP-seq
MIRT2079633	hsa-miR-378	CLIP-seq
MIRT2079634	hsa-miR-378b	CLIP-seq
MIRT2079635	hsa-miR-378c	CLIP-seq
MIRT2079636	hsa-miR-378d	CLIP-seq
MIRT2079637	hsa-miR-378e	CLIP-seq
MIRT2079638	hsa-miR-378f	CLIP-seq
MIRT2079639	hsa-miR-378h	CLIP-seq
MIRT2079640	hsa-miR-378i	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT2079641	hsa-miR-3916	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT2079642	hsa-miR-3928	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270807	hsa-miR-3973	CLIP-seq
MIRT2079643	hsa-miR-422a	CLIP-seq
MIRT2079644	hsa-miR-424	CLIP-seq
MIRT1270809	hsa-miR-4251	CLIP-seq
MIRT2079645	hsa-miR-4254	CLIP-seq
MIRT2079646	hsa-miR-4300	CLIP-seq
MIRT1270812	hsa-miR-4318	CLIP-seq
MIRT2079647	hsa-miR-4324	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT2079648	hsa-miR-4430	CLIP-seq
MIRT2079649	hsa-miR-4433	CLIP-seq
MIRT2079650	hsa-miR-4447	CLIP-seq
MIRT2079651	hsa-miR-4450	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT2079652	hsa-miR-4455	CLIP-seq
MIRT2079653	hsa-miR-4468	CLIP-seq
MIRT2079654	hsa-miR-4472	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270819	hsa-miR-4483	CLIP-seq
MIRT1270821	hsa-miR-449a	CLIP-seq
MIRT1270822	hsa-miR-449b	CLIP-seq
MIRT2079655	hsa-miR-4505	CLIP-seq
MIRT2079656	hsa-miR-4524	CLIP-seq
MIRT1270827	hsa-miR-4533	CLIP-seq
MIRT2079657	hsa-miR-4535	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT1270829	hsa-miR-455-3p	CLIP-seq
MIRT2079658	hsa-miR-4638-3p	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT2079659	hsa-miR-4646-5p	CLIP-seq
MIRT1270831	hsa-miR-4648	CLIP-seq
MIRT2079660	hsa-miR-4649-3p	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT2079661	hsa-miR-4653-3p	CLIP-seq
MIRT1270833	hsa-miR-4654	CLIP-seq
MIRT2079662	hsa-miR-4656	CLIP-seq
MIRT1270835	hsa-miR-4661-3p	CLIP-seq
MIRT2079663	hsa-miR-4668-5p	CLIP-seq
MIRT1270837	hsa-miR-4672	CLIP-seq
MIRT1270838	hsa-miR-4678	CLIP-seq
MIRT1270839	hsa-miR-4681	CLIP-seq
MIRT1270840	hsa-miR-4685-5p	CLIP-seq
MIRT1270841	hsa-miR-4688	CLIP-seq
MIRT1270846	hsa-miR-4701-3p	CLIP-seq
MIRT1270849	hsa-miR-4717-3p	CLIP-seq
MIRT1270850	hsa-miR-4719	CLIP-seq
MIRT1270853	hsa-miR-4728-5p	CLIP-seq
MIRT2079664	hsa-miR-4731-3p	CLIP-seq
MIRT1270854	hsa-miR-4733-3p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270856	hsa-miR-4738-3p	CLIP-seq
MIRT1270859	hsa-miR-4747-5p	CLIP-seq
MIRT1270862	hsa-miR-4758-3p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT1270864	hsa-miR-4769-5p	CLIP-seq
MIRT1270870	hsa-miR-4796-3p	CLIP-seq
MIRT2079665	hsa-miR-4801	CLIP-seq
MIRT1270872	hsa-miR-4802-3p	CLIP-seq
MIRT2079666	hsa-miR-490-3p	CLIP-seq
MIRT2079667	hsa-miR-491-5p	CLIP-seq
MIRT2079668	hsa-miR-492	CLIP-seq
MIRT1270877	hsa-miR-495	CLIP-seq
MIRT2079669	hsa-miR-497	CLIP-seq
MIRT2079670	hsa-miR-499-3p	CLIP-seq
MIRT2079671	hsa-miR-499a-3p	CLIP-seq
MIRT2079672	hsa-miR-503	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270880	hsa-miR-516b	CLIP-seq
MIRT1270886	hsa-miR-520g	CLIP-seq
MIRT1270887	hsa-miR-520h	CLIP-seq
MIRT1270888	hsa-miR-539	CLIP-seq
MIRT2079673	hsa-miR-544b	CLIP-seq
MIRT2079674	hsa-miR-548a-3p	CLIP-seq
MIRT2079675	hsa-miR-548ac	CLIP-seq
MIRT2079676	hsa-miR-548ae	CLIP-seq
MIRT2079677	hsa-miR-548aj	CLIP-seq
MIRT2079678	hsa-miR-548am	CLIP-seq
MIRT2079679	hsa-miR-548an	CLIP-seq
MIRT2079680	hsa-miR-548d-3p	CLIP-seq
MIRT2079681	hsa-miR-548e	CLIP-seq
MIRT2079682	hsa-miR-548f	CLIP-seq
MIRT2079683	hsa-miR-548x	CLIP-seq
MIRT2079684	hsa-miR-548z	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT1270896	hsa-miR-578	CLIP-seq
MIRT2079685	hsa-miR-609	CLIP-seq
MIRT2079686	hsa-miR-619	CLIP-seq
MIRT2079687	hsa-miR-646	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT2079688	hsa-miR-665	CLIP-seq
MIRT2079689	hsa-miR-708	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT2079690	hsa-miR-892b	CLIP-seq
MIRT2079691	hsa-miR-920	CLIP-seq
MIRT2305956	hsa-miR-1197	CLIP-seq
MIRT2079604	hsa-miR-1200	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT2079605	hsa-miR-1252	CLIP-seq
MIRT1270756	hsa-miR-1262	CLIP-seq
MIRT1270760	hsa-miR-132	CLIP-seq
MIRT2079606	hsa-miR-15a	CLIP-seq
MIRT2079607	hsa-miR-15b	CLIP-seq
MIRT2079608	hsa-miR-16	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT1270763	hsa-miR-186	CLIP-seq
MIRT2079611	hsa-miR-195	CLIP-seq
MIRT1270768	hsa-miR-212	CLIP-seq
MIRT2079614	hsa-miR-2355-5p	CLIP-seq
MIRT2305957	hsa-miR-3121-3p	CLIP-seq
MIRT2305958	hsa-miR-3124-3p	CLIP-seq
MIRT1270777	hsa-miR-3179	CLIP-seq
MIRT2305959	hsa-miR-3182	CLIP-seq
MIRT1270782	hsa-miR-3202	CLIP-seq
MIRT1270783	hsa-miR-323-3p	CLIP-seq
MIRT1270785	hsa-miR-329	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT2305960	hsa-miR-3617	CLIP-seq
MIRT1270792	hsa-miR-362-3p	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT2305961	hsa-miR-3667-3p	CLIP-seq
MIRT2079631	hsa-miR-3679-3p	CLIP-seq
MIRT2079632	hsa-miR-3692	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270806	hsa-miR-3941	CLIP-seq
MIRT2079644	hsa-miR-424	CLIP-seq
MIRT1270809	hsa-miR-4251	CLIP-seq
MIRT2305962	hsa-miR-4258	CLIP-seq
MIRT1270810	hsa-miR-4271	CLIP-seq
MIRT2079647	hsa-miR-4324	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT2305963	hsa-miR-4438	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT2079653	hsa-miR-4468	CLIP-seq
MIRT2305964	hsa-miR-4476	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270827	hsa-miR-4533	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT2079660	hsa-miR-4649-3p	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT1270833	hsa-miR-4654	CLIP-seq
MIRT1270834	hsa-miR-466	CLIP-seq
MIRT1270835	hsa-miR-4661-3p	CLIP-seq
MIRT2305965	hsa-miR-4664-3p	CLIP-seq
MIRT1270839	hsa-miR-4681	CLIP-seq
MIRT2305966	hsa-miR-4687-5p	CLIP-seq
MIRT1270841	hsa-miR-4688	CLIP-seq
MIRT1270844	hsa-miR-4696	CLIP-seq
MIRT1270846	hsa-miR-4701-3p	CLIP-seq
MIRT1270847	hsa-miR-4707-5p	CLIP-seq
MIRT1270849	hsa-miR-4717-3p	CLIP-seq
MIRT2305967	hsa-miR-4720-5p	CLIP-seq
MIRT1270852	hsa-miR-4725-3p	CLIP-seq
MIRT1270854	hsa-miR-4733-3p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270856	hsa-miR-4738-3p	CLIP-seq
MIRT1270859	hsa-miR-4747-5p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT2305968	hsa-miR-4766-5p	CLIP-seq
MIRT1270864	hsa-miR-4769-5p	CLIP-seq
MIRT1270867	hsa-miR-4789-3p	CLIP-seq
MIRT2305969	hsa-miR-4799-3p	CLIP-seq
MIRT1270872	hsa-miR-4802-3p	CLIP-seq
MIRT1270873	hsa-miR-4802-5p	CLIP-seq
MIRT1270877	hsa-miR-495	CLIP-seq
MIRT2079669	hsa-miR-497	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270881	hsa-miR-518a-3p	CLIP-seq
MIRT1270882	hsa-miR-518b	CLIP-seq
MIRT1270883	hsa-miR-518c	CLIP-seq
MIRT1270884	hsa-miR-518d-3p	CLIP-seq
MIRT1270885	hsa-miR-518f	CLIP-seq
MIRT1270888	hsa-miR-539	CLIP-seq
MIRT2079673	hsa-miR-544b	CLIP-seq
MIRT2305970	hsa-miR-549	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT1270896	hsa-miR-578	CLIP-seq
MIRT1270897	hsa-miR-590-3p	CLIP-seq
MIRT1270898	hsa-miR-603	CLIP-seq
MIRT1270899	hsa-miR-625	CLIP-seq
MIRT2305971	hsa-miR-641	CLIP-seq
MIRT1270900	hsa-miR-642a	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT2305972	hsa-miR-671-3p	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT1270912	hsa-miR-944	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT2079606	hsa-miR-15a	CLIP-seq
MIRT2079607	hsa-miR-15b	CLIP-seq
MIRT2079608	hsa-miR-16	CLIP-seq
MIRT2079611	hsa-miR-195	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT2079644	hsa-miR-424	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT2079669	hsa-miR-497	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT2603178	hsa-miR-1268	CLIP-seq
MIRT2603179	hsa-miR-1268b	CLIP-seq
MIRT1270757	hsa-miR-1275	CLIP-seq
MIRT1270761	hsa-miR-1321	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT1270771	hsa-miR-298	CLIP-seq
MIRT2079616	hsa-miR-3064-5p	CLIP-seq
MIRT2603180	hsa-miR-3140-5p	CLIP-seq
MIRT2079625	hsa-miR-3153	CLIP-seq
MIRT1270778	hsa-miR-3183	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT2079627	hsa-miR-3607-5p	CLIP-seq
MIRT2079628	hsa-miR-3652	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT2079630	hsa-miR-3678-3p	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270806	hsa-miR-3941	CLIP-seq
MIRT2603181	hsa-miR-412	CLIP-seq
MIRT1270811	hsa-miR-4294	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT2079648	hsa-miR-4430	CLIP-seq
MIRT2079649	hsa-miR-4433	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT1270817	hsa-miR-4469	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270824	hsa-miR-4501	CLIP-seq
MIRT1270825	hsa-miR-4504	CLIP-seq
MIRT2079655	hsa-miR-4505	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT2603182	hsa-miR-455-5p	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT2079659	hsa-miR-4646-5p	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT2079662	hsa-miR-4656	CLIP-seq
MIRT1270834	hsa-miR-466	CLIP-seq
MIRT1270836	hsa-miR-4665-5p	CLIP-seq
MIRT2079663	hsa-miR-4668-5p	CLIP-seq
MIRT1270841	hsa-miR-4688	CLIP-seq
MIRT1270847	hsa-miR-4707-5p	CLIP-seq
MIRT1270851	hsa-miR-4723-3p	CLIP-seq
MIRT1270853	hsa-miR-4728-5p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270857	hsa-miR-4739	CLIP-seq
MIRT1270858	hsa-miR-4742-3p	CLIP-seq
MIRT1270860	hsa-miR-4752	CLIP-seq
MIRT1270861	hsa-miR-4756-5p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT2305968	hsa-miR-4766-5p	CLIP-seq
MIRT1270865	hsa-miR-4783-3p	CLIP-seq
MIRT1270867	hsa-miR-4789-3p	CLIP-seq
MIRT1270869	hsa-miR-4795-3p	CLIP-seq
MIRT2603183	hsa-miR-488	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270889	hsa-miR-542-3p	CLIP-seq
MIRT2079674	hsa-miR-548a-3p	CLIP-seq
MIRT2079679	hsa-miR-548an	CLIP-seq
MIRT2079681	hsa-miR-548e	CLIP-seq
MIRT2079682	hsa-miR-548f	CLIP-seq
MIRT1270893	hsa-miR-548m	CLIP-seq
MIRT1270894	hsa-miR-567	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT2603184	hsa-miR-585	CLIP-seq
MIRT1270900	hsa-miR-642a	CLIP-seq
MIRT1270902	hsa-miR-654-3p	CLIP-seq
MIRT1270903	hsa-miR-656	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT2079688	hsa-miR-665	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT2079690	hsa-miR-892b	CLIP-seq
MIRT1270753	hsa-miR-1205	CLIP-seq
MIRT1270754	hsa-miR-1207-5p	CLIP-seq
MIRT2079605	hsa-miR-1252	CLIP-seq
MIRT2603178	hsa-miR-1268	CLIP-seq
MIRT2603179	hsa-miR-1268b	CLIP-seq
MIRT1270757	hsa-miR-1275	CLIP-seq
MIRT2688859	hsa-miR-1291	CLIP-seq
MIRT1270761	hsa-miR-1321	CLIP-seq
MIRT2079606	hsa-miR-15a	CLIP-seq
MIRT2079607	hsa-miR-15b	CLIP-seq
MIRT2079608	hsa-miR-16	CLIP-seq
MIRT1270762	hsa-miR-185	CLIP-seq
MIRT2079609	hsa-miR-193a-3p	CLIP-seq
MIRT2079610	hsa-miR-193b	CLIP-seq
MIRT2079611	hsa-miR-195	CLIP-seq
MIRT1270771	hsa-miR-298	CLIP-seq
MIRT2079616	hsa-miR-3064-5p	CLIP-seq
MIRT2603180	hsa-miR-3140-5p	CLIP-seq
MIRT2079625	hsa-miR-3153	CLIP-seq
MIRT1552662	hsa-miR-3162-5p	CLIP-seq
MIRT2305959	hsa-miR-3182	CLIP-seq
MIRT1270778	hsa-miR-3183	CLIP-seq
MIRT2688860	hsa-miR-3192	CLIP-seq
MIRT2688861	hsa-miR-328	CLIP-seq
MIRT1270788	hsa-miR-34a	CLIP-seq
MIRT1270789	hsa-miR-34c-5p	CLIP-seq
MIRT1270790	hsa-miR-3529	CLIP-seq
MIRT2079627	hsa-miR-3607-5p	CLIP-seq
MIRT2079628	hsa-miR-3652	CLIP-seq
MIRT1270796	hsa-miR-3665	CLIP-seq
MIRT2079630	hsa-miR-3678-3p	CLIP-seq
MIRT1552663	hsa-miR-3714	CLIP-seq
MIRT1270803	hsa-miR-379	CLIP-seq
MIRT1270804	hsa-miR-3925-3p	CLIP-seq
MIRT1270805	hsa-miR-3929	CLIP-seq
MIRT1270806	hsa-miR-3941	CLIP-seq
MIRT2603181	hsa-miR-412	CLIP-seq
MIRT2079644	hsa-miR-424	CLIP-seq
MIRT1270811	hsa-miR-4294	CLIP-seq
MIRT2688862	hsa-miR-4314	CLIP-seq
MIRT1270813	hsa-miR-4418	CLIP-seq
MIRT1270814	hsa-miR-4419b	CLIP-seq
MIRT2079648	hsa-miR-4430	CLIP-seq
MIRT2079649	hsa-miR-4433	CLIP-seq
MIRT1270816	hsa-miR-4451	CLIP-seq
MIRT1270817	hsa-miR-4469	CLIP-seq
MIRT2305964	hsa-miR-4476	CLIP-seq
MIRT1270818	hsa-miR-4478	CLIP-seq
MIRT1270821	hsa-miR-449a	CLIP-seq
MIRT1270822	hsa-miR-449b	CLIP-seq
MIRT1270824	hsa-miR-4501	CLIP-seq
MIRT1270825	hsa-miR-4504	CLIP-seq
MIRT2079655	hsa-miR-4505	CLIP-seq
MIRT2079656	hsa-miR-4524	CLIP-seq
MIRT1270827	hsa-miR-4533	CLIP-seq
MIRT1270828	hsa-miR-4536	CLIP-seq
MIRT2603182	hsa-miR-455-5p	CLIP-seq
MIRT1270830	hsa-miR-4643	CLIP-seq
MIRT2079659	hsa-miR-4646-5p	CLIP-seq
MIRT1270832	hsa-miR-4650-3p	CLIP-seq
MIRT2079662	hsa-miR-4656	CLIP-seq
MIRT1270834	hsa-miR-466	CLIP-seq
MIRT1270835	hsa-miR-4661-3p	CLIP-seq
MIRT1270836	hsa-miR-4665-5p	CLIP-seq
MIRT2079663	hsa-miR-4668-5p	CLIP-seq
MIRT1270837	hsa-miR-4672	CLIP-seq
MIRT1270841	hsa-miR-4688	CLIP-seq
MIRT1270847	hsa-miR-4707-5p	CLIP-seq
MIRT1270849	hsa-miR-4717-3p	CLIP-seq
MIRT1270851	hsa-miR-4723-3p	CLIP-seq
MIRT1270853	hsa-miR-4728-5p	CLIP-seq
MIRT1270855	hsa-miR-4736	CLIP-seq
MIRT1270857	hsa-miR-4739	CLIP-seq
MIRT1270858	hsa-miR-4742-3p	CLIP-seq
MIRT1270859	hsa-miR-4747-5p	CLIP-seq
MIRT1270860	hsa-miR-4752	CLIP-seq
MIRT1270861	hsa-miR-4756-5p	CLIP-seq
MIRT1270863	hsa-miR-4763-3p	CLIP-seq
MIRT2305968	hsa-miR-4766-5p	CLIP-seq
MIRT1270865	hsa-miR-4783-3p	CLIP-seq
MIRT1270867	hsa-miR-4789-3p	CLIP-seq
MIRT1270869	hsa-miR-4795-3p	CLIP-seq
MIRT2688863	hsa-miR-4797-5p	CLIP-seq
MIRT1270872	hsa-miR-4802-3p	CLIP-seq
MIRT2603183	hsa-miR-488	CLIP-seq
MIRT2079669	hsa-miR-497	CLIP-seq
MIRT2079672	hsa-miR-503	CLIP-seq
MIRT1270878	hsa-miR-509-3-5p	CLIP-seq
MIRT1270879	hsa-miR-509-5p	CLIP-seq
MIRT1270889	hsa-miR-542-3p	CLIP-seq
MIRT2079674	hsa-miR-548a-3p	CLIP-seq
MIRT2079679	hsa-miR-548an	CLIP-seq
MIRT2079681	hsa-miR-548e	CLIP-seq
MIRT2079682	hsa-miR-548f	CLIP-seq
MIRT1270893	hsa-miR-548m	CLIP-seq
MIRT1270894	hsa-miR-567	CLIP-seq
MIRT1270895	hsa-miR-570	CLIP-seq
MIRT2603184	hsa-miR-585	CLIP-seq
MIRT1270900	hsa-miR-642a	CLIP-seq
MIRT2079687	hsa-miR-646	CLIP-seq
MIRT1270902	hsa-miR-654-3p	CLIP-seq
MIRT1270903	hsa-miR-656	CLIP-seq
MIRT1270904	hsa-miR-657	CLIP-seq
MIRT2079688	hsa-miR-665	CLIP-seq
MIRT1270908	hsa-miR-766	CLIP-seq
MIRT2079690	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0002039	Function	P53 binding	IDA	18309296
GO:0005515	Function	Protein binding	IPI	12970408, 16189514, 16439211, 16713569, 18309296, 20580715, 21516116, 22190034, 24722188, 25416956, 26871637, 27107012, 29934401, 32296183, 32703419, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005929	Component	Cilium	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0008537	Component	Proteasome activator complex	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0036064	Component	Ciliary basal body	IDA
GO:0042802	Function	Identical protein binding	IPI	16169070, 16189514, 25416956, 27107012, 32296183
GO:0061133	Function	Endopeptidase activator activity	IBA
GO:0061133	Function	Endopeptidase activator activity	IDA	18309296
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IBA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	18309296
GO:0097371	Function	MDM2/MDM4 family protein binding	IDA	18309296
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	18309296

Other IDs

• MIM: 605129
• HGNC: 9570
• e!Ensembl: ENSG00000131467

Protein

• UniProt ID: P61289
• Protein name: Proteasome activator complex subunit 3 (11S regulator complex subunit gamma) (REG-gamma) (Activator of multicatalytic protease subunit 3) (Ki nuclear autoantigen) (Proteasome activator 28 subunit gamma) (PA28g) (PA28gamma)
• Protein function: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymot
• PDB: 7YQC , 7YQD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02251	PA28_alpha	9 → 69	Proteasome activator pa28 alpha subunit	Family
  PF02252	PA28_beta	108 → 252	Proteasome activator pa28 beta subunit	Family

• Sequence:

  MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
  DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
  KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
  RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
  KIKRPRSSNAETLY

• Sequence length: 254

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Antigen processing and presentation	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Hepatitis C	Cross-presentation of soluble exogenous antigens (endosomes)
	Autodegradation of Cdh1 by Cdh1:APC/C
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (73)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	31243343		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31243343		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31282281		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25482151	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	21216954		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31282281		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36320054	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25482151	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31171475		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20467919, 25511742, 28529105		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	28596723		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34745496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31767934		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31668016		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29437787		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29437787, 31616162		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29437787		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16893879, 31630568	Associate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	25482151	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28969047, 29795381		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25697482		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24011073		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	31205573		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	17327906	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26944602		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31668016		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36320054	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	22938444	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31605415		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17234812, 27902328, 29611800		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12784391		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	1968796, 21474795	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12784391		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12784391		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31171475		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12784391		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29509725, 36515625	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20467919, 25511742, 28529105		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25697482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31767934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31605415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27756569, 31205573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28861169		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31542615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31491459		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22361172, 24281003, 28529105, 29437787, 31205573, 31243343, 31605415		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29437787, 31616162		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29437787		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28605165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	29020881		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29020881, 35344764	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24281003, 25697482, 27756569, 28529105, 29437787, 29509725, 29702196, 31243343, 31767934		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24281003		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	35961969	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27756569, 31205573		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35422493	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29509725		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	25908095		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28861169		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28969047, 29795381		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24901344		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25482151	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29702196		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35961969	Stimulate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19187070, 24011073		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31542615		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36515625	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29509725	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22415115, 31491459		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31243343	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31491459		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22415115	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	31243343	Inhibit	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSME1 52 shared pathwaysProteasome, Antigen processing and presentation, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D +40 more Related via 52 shared pathways including Proteasome, Antigen processing and presentation. PSME2 52 shared pathwaysProteasome, Antigen processing and presentation, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D +40 more Related via 52 shared pathways including Proteasome, Antigen processing and presentation. PSMB9 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMB10 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMF1 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSME1	0	[]	52	["Proteasome","Antigen processing and presentation","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D"]	0	[]
PSME2	0	[]	52	["Proteasome","Antigen processing and presentation","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D"]	0	[]
PSMB9	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMB10	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMF1	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]

Diseases Linked via Similar Genes

Esophageal squamous cell carcinoma Linked via 2 of 5 related genesPSME1, PSME2 Proteasome associated autoinflammatory syndrome Linked via 2 of 5 related genesPSMB9, PSMB10 Carcinoma Linked via 1 of 5 related genesPSME1 Ankylosing spondylitis Linked via 1 of 5 related genesPSMB9 Autism Linked via 1 of 5 related genesPSMB9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Esophageal squamous cell carcinoma	2	["PSME1","PSME2"]
Proteasome associated autoinflammatory syndrome	2	["PSMB9","PSMB10"]
Carcinoma	1	["PSME1"]
Ankylosing spondylitis	1	["PSMB9"]
Autism	1	["PSMB9"]