Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9986
Gene name Gene Name - the full gene name approved by the HGNC.	Ras converting CAAX endopeptidase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RCE1
Synonyms (NCBI Gene) Gene synonyms aliases	FACE2, RCE1A, RCE1B
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030395	hsa-miR-24-3p	Microarray	19748357
MIRT042110	hsa-miR-484	CLASH	23622248
MIRT038128	hsa-miR-423-5p	CLASH	23622248
MIRT459207	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT459206	hsa-miR-4259	PAR-CLIP	23592263
MIRT459205	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459204	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT459203	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT459202	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT459200	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT459201	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT459199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT459198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT459197	hsa-miR-4651	PAR-CLIP	23592263
MIRT459196	hsa-miR-608	PAR-CLIP	23592263
MIRT459195	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT459194	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT459193	hsa-miR-4447	PAR-CLIP	23592263
MIRT459192	hsa-miR-4472	PAR-CLIP	23592263
MIRT459191	hsa-miR-1275	PAR-CLIP	23592263
MIRT459190	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT459188	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT459189	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT459187	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT459207	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT459206	hsa-miR-4259	PAR-CLIP	23592263
MIRT459205	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459204	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT459203	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT459202	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT459200	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT459201	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT459199	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT459198	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT459197	hsa-miR-4651	PAR-CLIP	23592263
MIRT459196	hsa-miR-608	PAR-CLIP	23592263
MIRT459195	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT459194	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT459193	hsa-miR-4447	PAR-CLIP	23592263
MIRT459192	hsa-miR-4472	PAR-CLIP	23592263
MIRT459191	hsa-miR-1275	PAR-CLIP	23592263
MIRT459190	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT459188	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT459189	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT459187	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1298224	hsa-miR-1827	CLIP-seq
MIRT1298225	hsa-miR-2467-3p	CLIP-seq
MIRT1298226	hsa-miR-3942-3p	CLIP-seq
MIRT1298227	hsa-miR-4257	CLIP-seq
MIRT1298228	hsa-miR-646	CLIP-seq
MIRT2088681	hsa-miR-1200	CLIP-seq
MIRT2088682	hsa-miR-1283	CLIP-seq
MIRT2088683	hsa-miR-4324	CLIP-seq
MIRT2088684	hsa-miR-491-5p	CLIP-seq
MIRT2088685	hsa-miR-544b	CLIP-seq
MIRT2313536	hsa-miR-103b	CLIP-seq
MIRT2313537	hsa-miR-3150a-3p	CLIP-seq
MIRT2313538	hsa-miR-3175	CLIP-seq
MIRT2313539	hsa-miR-376a	CLIP-seq
MIRT2313540	hsa-miR-376b	CLIP-seq
MIRT2313541	hsa-miR-4446-3p	CLIP-seq
MIRT2313542	hsa-miR-4492	CLIP-seq
MIRT2313543	hsa-miR-4498	CLIP-seq
MIRT2313544	hsa-miR-4505	CLIP-seq
MIRT2313545	hsa-miR-4667-5p	CLIP-seq
MIRT2313546	hsa-miR-4693-3p	CLIP-seq
MIRT2313547	hsa-miR-4700-5p	CLIP-seq
MIRT2313548	hsa-miR-4721	CLIP-seq
MIRT2313549	hsa-miR-4728-5p	CLIP-seq
MIRT2313550	hsa-miR-4731-5p	CLIP-seq
MIRT2088684	hsa-miR-491-5p	CLIP-seq
MIRT2313551	hsa-miR-541	CLIP-seq
MIRT2313552	hsa-miR-654-5p	CLIP-seq
MIRT2313553	hsa-miR-762	CLIP-seq
MIRT2313554	hsa-miR-939	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IDA	19188362
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA	21873635
GO:0004222	Function	Metalloendopeptidase activity	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19188362
GO:0005829	Component	Cytosol	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10085068
GO:0008238	Function	Exopeptidase activity	IDA	10085068
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0018342	Process	Protein prenylation	IDA	10085068
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IBA	21873635
GO:0071586	Process	CAAX-box protein processing	IBA	21873635
GO:0071586	Process	CAAX-box protein processing	IDA	10085068
GO:0071586	Process	CAAX-box protein processing	IMP	19188362

MIM	HGNC	e!Ensembl
605385	13721	ENSG00000173653

Protein

UniProt ID

Q9Y256

Protein name

CAAX prenyl protease 2 (EC 3.4.26.1) (Farnesylated proteins-converting enzyme 2) (FACE-2) (Prenyl protein-specific endoprotease 2) (RCE1 homolog) (hRCE1)

Protein function

Protease involved in the processing of a variety of prenylated proteins containing the C-terminal CAAX motif, where C is a cysteine modified with an isoprenoid lipid, A is an aliphatic amino acid and X is any C-terminal amino acid. Proteolytical

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02517	CPBP	148 → 267	CPBP intramembrane metalloprotease	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10085068}.

Sequence

MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL
PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCVLLERAGDSEAPLCS

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	Terpenoid backbone biosynthesis		Ub-specific processing proteases

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	28615075
Carcinoma Renal Cell	Associate	28159979
Colorectal Neoplasms	Inhibit	28615075
Neoplasms	Inhibit	28615075

RCE1 (Ras converting CAAX endopeptidase 1)