FGF19 (fibroblast growth factor 19)

Gene

• Entrez ID: 9965
• Gene name: Fibroblast growth factor 19
• Gene symbol: FGF19
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT995620	hsa-miR-1207-3p	CLIP-seq
MIRT995621	hsa-miR-1285	CLIP-seq
MIRT995622	hsa-miR-136	CLIP-seq
MIRT995623	hsa-miR-148a	CLIP-seq
MIRT995624	hsa-miR-148b	CLIP-seq
MIRT995625	hsa-miR-152	CLIP-seq
MIRT995626	hsa-miR-2355-5p	CLIP-seq
MIRT995627	hsa-miR-3174	CLIP-seq
MIRT995628	hsa-miR-3187-5p	CLIP-seq
MIRT995629	hsa-miR-3681	CLIP-seq
MIRT995630	hsa-miR-370	CLIP-seq
MIRT995631	hsa-miR-4272	CLIP-seq
MIRT995632	hsa-miR-4329	CLIP-seq
MIRT995633	hsa-miR-4514	CLIP-seq
MIRT995634	hsa-miR-4645-5p	CLIP-seq
MIRT995635	hsa-miR-4673	CLIP-seq
MIRT995636	hsa-miR-4692	CLIP-seq
MIRT995637	hsa-miR-4797-5p	CLIP-seq
MIRT995638	hsa-miR-495	CLIP-seq
MIRT995639	hsa-miR-498	CLIP-seq
MIRT995640	hsa-miR-612	CLIP-seq
MIRT995641	hsa-miR-646	CLIP-seq
MIRT995642	hsa-miR-759	CLIP-seq
MIRT995643	hsa-miR-889	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	23205607
FOXC1	Activation	17000708
NR1I2	Activation	17696253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	17627937
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	10525310, 17627937
GO:0005515	Function	Protein binding	IPI	18829467
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007399	Process	Nervous system development	TAS	9931477
GO:0007507	Process	Heart development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10525310
GO:0009617	Process	Response to bacterium	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	19085950
GO:0022008	Process	Neurogenesis	IBA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045471	Process	Response to ethanol	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IDA	17623664
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12815072
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17623664, 19085950
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IDA	12815072
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IEA

Other IDs

• MIM: 603891
• HGNC: 3675
• e!Ensembl: ENSG00000162344

Protein

• UniProt ID: O95750
• Protein name: Fibroblast growth factor 19 (FGF-19)
• Protein function: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and
• PDB: 1PWA, 2P23, 6KTR, 6NFJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	43 → 157	Fibroblast growth factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO:0000269|PubMed:10525310}.
• Sequence:

  MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
  RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
  AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
  GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

• Sequence length: 216

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling