FGF19 (fibroblast growth factor 19)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9965
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF19
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(90)
miRTarBase ID miRNA Experiments Reference
MIRT639625 hsa-miR-4762-5p HITS-CLIP 23824327
MIRT648603 hsa-miR-29a-5p HITS-CLIP 23824327
MIRT639624 hsa-miR-676-5p HITS-CLIP 23824327
MIRT639623 hsa-miR-627-3p HITS-CLIP 23824327
MIRT639622 hsa-miR-615-5p HITS-CLIP 23824327
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
ATF4 Activation 23205607
FOXC1 Activation 17000708
NR1I2 Activation 17696253
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0001755 Process Neural crest cell migration IEA
GO:0001934 Process Positive regulation of protein phosphorylation IDA 17627937
GO:0005104 Function Fibroblast growth factor receptor binding IBA
GO:0005104 Function Fibroblast growth factor receptor binding IEA
GO:0005104 Function Fibroblast growth factor receptor binding IPI 10525310, 17627937
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603891 3675 ENSG00000162344
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95750
Protein name Fibroblast growth factor 19 (FGF-19)
Protein function Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and
PDB 1PWA , 2P23 , 6KTR , 6NFJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 43 → 157 Fibroblast growth factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO:0000269|PubMed:10525310}.
Sequence 
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Sequence length 216
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer 		  PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Gout Gout N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Show/Hide Text Mining Associations (76)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 39929297
Aortic Valve Stenosis Inhibit 39217396
Bile Acid Malabsorption Primary Associate 26856750
Biliary Atresia Associate 31976601
Biliary Atresia Stimulate 36692476
Bipolar Disorder Associate 38484669
Blindness Stimulate 27384874
Breast Neoplasms Associate 24811890, 27192118, 39261800
Bronchopulmonary Dysplasia Associate 31967847
Carcinogenesis Associate 22761904, 28906590