FGF19 (fibroblast growth factor 19)

Gene

• Entrez ID: 9965
• Gene name: Fibroblast growth factor 19
• Gene symbol: FGF19
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT648603	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT648602	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT648601	hsa-miR-1200	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT648600	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT648599	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT639625	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT639624	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639623	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT639622	hsa-miR-615-5p	HITS-CLIP	23824327
MIRT639621	hsa-miR-7704	HITS-CLIP	23824327
MIRT639620	hsa-miR-193a-5p	HITS-CLIP	23824327
MIRT639618	hsa-miR-3671	HITS-CLIP	23824327
MIRT639619	hsa-miR-6737-5p	HITS-CLIP	23824327
MIRT639617	hsa-miR-6812-5p	HITS-CLIP	23824327
MIRT639616	hsa-miR-6819-5p	HITS-CLIP	23824327
MIRT639615	hsa-miR-3170	HITS-CLIP	23824327
MIRT639614	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT639613	hsa-miR-607	HITS-CLIP	23824327
MIRT639612	hsa-miR-5572	HITS-CLIP	23824327
MIRT995620	hsa-miR-1207-3p	CLIP-seq
MIRT995621	hsa-miR-1285	CLIP-seq
MIRT995622	hsa-miR-136	CLIP-seq
MIRT995623	hsa-miR-148a	CLIP-seq
MIRT995624	hsa-miR-148b	CLIP-seq
MIRT995625	hsa-miR-152	CLIP-seq
MIRT995626	hsa-miR-2355-5p	CLIP-seq
MIRT995627	hsa-miR-3174	CLIP-seq
MIRT995628	hsa-miR-3187-5p	CLIP-seq
MIRT995629	hsa-miR-3681	CLIP-seq
MIRT995630	hsa-miR-370	CLIP-seq
MIRT995631	hsa-miR-4272	CLIP-seq
MIRT995632	hsa-miR-4329	CLIP-seq
MIRT995633	hsa-miR-4514	CLIP-seq
MIRT995634	hsa-miR-4645-5p	CLIP-seq
MIRT995635	hsa-miR-4673	CLIP-seq
MIRT995636	hsa-miR-4692	CLIP-seq
MIRT995637	hsa-miR-4797-5p	CLIP-seq
MIRT995638	hsa-miR-495	CLIP-seq
MIRT995639	hsa-miR-498	CLIP-seq
MIRT995640	hsa-miR-612	CLIP-seq
MIRT995641	hsa-miR-646	CLIP-seq
MIRT995642	hsa-miR-759	CLIP-seq
MIRT995643	hsa-miR-889	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	23205607
FOXC1	Activation	17000708
NR1I2	Activation	17696253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	17627937
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA	21873635
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	10525310, 17627937
GO:0005515	Function	Protein binding	IPI	18829467
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007399	Process	Nervous system development	TAS	9931477
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10525310
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0009887	Process	Animal organ morphogenesis	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010629	Process	Negative regulation of gene expression	IDA	19085950
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030334	Process	Regulation of cell migration	IBA	21873635
GO:0046326	Process	Positive regulation of glucose import	IDA	17623664
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12815072
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17623664, 19085950
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IDA	12815072

Other IDs

• MIM: 603891
• HGNC: 3675
• e!Ensembl: ENSG00000162344

Protein

• UniProt ID: O95750
• Protein name: Fibroblast growth factor 19 (FGF-19)
• Protein function: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and
• PDB: 1PWA, 2P23, 6KTR, 6NFJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	43 → 157	Fibroblast growth factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO:0000269|PubMed:10525310}.
• Sequence:

  MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
  RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
  AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
  GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

• Sequence length: 216

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Mental Depression	Mental Depression			GWAS
Gout	Gout			GWAS
Alzheimer disease	Alzheimer disease			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	39929297
Aortic Valve Stenosis	Inhibit	39217396
Bile Acid Malabsorption Primary	Associate	26856750
Biliary Atresia	Associate	31976601
Biliary Atresia	Stimulate	36692476
Bipolar Disorder	Associate	38484669
Blindness	Stimulate	27384874
Breast Neoplasms	Associate	24811890, 27192118, 39261800
Bronchopulmonary Dysplasia	Associate	31967847
Carcinogenesis	Associate	22761904, 28906590
Carcinoma	Associate	32487254
Carcinoma Ductal Breast	Associate	24248542
Carcinoma Hepatocellular	Associate	22309595, 23285165, 26498355, 27384874, 28069043, 30373752, 31063779, 31575541, 32219747, 33754043, 33794926, 35659630, 35874743, 36179047, 38048735
Carcinoma Hepatocellular	Stimulate	27447573
Carcinoma Squamous Cell	Associate	26943773, 28906590
Chemical and Drug Induced Liver Injury	Associate	23840612, 27976737, 35493499
Cholangiocarcinoma	Associate	26498355
Cholestasis	Associate	28570655
Cholestasis Extrahepatic	Stimulate	28570655
Cleft Lip	Associate	22074045
Cognition Disorders	Associate	39566744
Colitis Ulcerative	Associate	28982144
Colorectal Neoplasms	Associate	23285165, 26498355, 36923538
Crohn Disease	Associate	23189156, 28982144, 39261800
Crohn Disease	Inhibit	34491321
Diabetes Gestational	Inhibit	24260557, 29734515
Diabetes Gestational	Associate	34982020
Diabetes Mellitus	Associate	23801799, 25664662
Diabetes Mellitus	Inhibit	28202005, 32344198
Diabetes Mellitus Type 2	Associate	23801799, 25664662
Diabetes Mellitus Type 2	Inhibit	28202005
Esophageal Squamous Cell Carcinoma	Associate	21734802, 22761904, 29866946, 31851786, 33725708, 34962019
Fatty Liver	Stimulate	27447573
Fatty Liver Alcoholic	Associate	23840612
Fibrosis	Inhibit	29654817
Fibrosis	Associate	29699061
Hepatitis Alcoholic	Stimulate	29654817
Hypertriglyceridemia	Associate	26856750
Hypoglycemia	Stimulate	30976983
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	26293907
Ileal Diseases	Inhibit	34491321
Inflammation	Associate	23670968, 39217396, 39566744
Inflammation	Inhibit	27976737
Insulin Resistance	Associate	23670968, 24260557
Intestinal Failure	Associate	34133768
Intrahepatic Cholestasis of Pregnancy	Associate	24366234
Keratoconus	Inhibit	38064228
Leukemia Myeloid Acute	Associate	26125711, 33284559
Liver Cirrhosis Biliary	Associate	26293907, 28570655
Liver Diseases	Associate	26293907, 30122083
Liver Diseases	Stimulate	31976601
Liver Failure	Associate	26293907, 31976601
Liver Neoplasms	Associate	27447573
Lung Neoplasms	Associate	22689099
Lymphatic Metastasis	Stimulate	24248542, 27053348
Melanoma	Associate	36739402, 36881068
Mental Disorders	Associate	39566744
Neoplasm Metastasis	Associate	26498355, 28939077
Neoplasms	Associate	22309595, 25822088, 26498355, 27192118, 28069043, 28906590, 31063779, 31575541, 36179047, 36751636, 37914932, 38048735
Neoplasms	Stimulate	27053348
Neural Tube Defects	Stimulate	33491544
Non alcoholic Fatty Liver Disease	Associate	23840612, 31655133, 32794259
Obesity	Associate	18469300, 23670968
Obesity	Inhibit	32344198
Ovarian Neoplasms	Associate	36751636
Polycystic Ovary Syndrome	Inhibit	24260557
Smoke Inhalation Injury	Stimulate	28906590
Squamous Cell Carcinoma of Head and Neck	Associate	34576070, 39432990
Stomach Neoplasms	Stimulate	27053348
Stomach Neoplasms	Associate	29866946, 34551773
Subarachnoid Hemorrhage	Associate	38173028
Systemic Inflammatory Response Syndrome	Associate	38040541
Tongue Neoplasms	Associate	28939077
Urethral Neoplasms	Associate	28972963
Weight Loss	Associate	28202005
Wounds and Injuries	Associate	34982020