Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9951
Gene name Gene Name - the full gene name approved by the HGNC.	Heparan sulfate-glucosamine 3-sulfotransferase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HS3ST4
Synonyms (NCBI Gene) Gene synonyms aliases	3-OST-4, 30ST4, 3OST4, h3-OST-4
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the enzyme heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4. This enzyme generates 3-O-sulfated glucosaminyl residues in heparan sulfate. Cell surface heparan sulfate is used as a receptor by herpes simplex virus type 1 (HSV-1), and

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments
MIRT1054958	hsa-miR-1293	CLIP-seq
MIRT1054959	hsa-miR-147	CLIP-seq
MIRT1054960	hsa-miR-298	CLIP-seq
MIRT1054961	hsa-miR-302a	CLIP-seq
MIRT1054962	hsa-miR-302b	CLIP-seq
MIRT1054963	hsa-miR-302c	CLIP-seq
MIRT1054964	hsa-miR-302d	CLIP-seq
MIRT1054965	hsa-miR-302e	CLIP-seq
MIRT1054966	hsa-miR-3152-5p	CLIP-seq
MIRT1054967	hsa-miR-3650	CLIP-seq
MIRT1054968	hsa-miR-372	CLIP-seq
MIRT1054969	hsa-miR-373	CLIP-seq
MIRT1054970	hsa-miR-3911	CLIP-seq
MIRT1054971	hsa-miR-4455	CLIP-seq
MIRT1054972	hsa-miR-4483	CLIP-seq
MIRT1054973	hsa-miR-4677-3p	CLIP-seq
MIRT1054974	hsa-miR-4679	CLIP-seq
MIRT1054975	hsa-miR-4774-3p	CLIP-seq
MIRT1054976	hsa-miR-520a-3p	CLIP-seq
MIRT1054977	hsa-miR-520b	CLIP-seq
MIRT1054978	hsa-miR-520c-3p	CLIP-seq
MIRT1054979	hsa-miR-520d-3p	CLIP-seq
MIRT1054980	hsa-miR-520e	CLIP-seq
MIRT1054981	hsa-miR-520f	CLIP-seq
MIRT1054982	hsa-miR-609	CLIP-seq
MIRT1054983	hsa-miR-644	CLIP-seq
MIRT2012495	hsa-miR-1289	CLIP-seq
MIRT2012496	hsa-miR-3157-5p	CLIP-seq
MIRT2012497	hsa-miR-3690	CLIP-seq
MIRT2012498	hsa-miR-4254	CLIP-seq
MIRT2012499	hsa-miR-4691-3p	CLIP-seq
MIRT2012500	hsa-miR-512-5p	CLIP-seq
MIRT2012495	hsa-miR-1289	CLIP-seq
MIRT2437641	hsa-miR-3160-5p	CLIP-seq
MIRT2437642	hsa-miR-3198	CLIP-seq
MIRT2437643	hsa-miR-4294	CLIP-seq
MIRT2437644	hsa-miR-4309	CLIP-seq
MIRT2012495	hsa-miR-1289	CLIP-seq
MIRT2437641	hsa-miR-3160-5p	CLIP-seq
MIRT2437642	hsa-miR-3198	CLIP-seq
MIRT2437643	hsa-miR-4294	CLIP-seq
MIRT2437644	hsa-miR-4309	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	21873635
GO:0008467	Function	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	NAS	9988767
GO:0016021	Component	Integral component of membrane	IEA
GO:0030201	Process	Heparan sulfate proteoglycan metabolic process	NAS	9988767

MIM	HGNC	e!Ensembl
604059	5200	ENSG00000182601

Protein

UniProt ID

Q9Y661

Protein name

Heparan sulfate glucosamine 3-O-sulfotransferase 4 (EC 2.8.2.23) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4) (3-OST-4) (Heparan sulfate 3-O-sulfotransferase 4) (h3-OST-4)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Unlike 3-OST-1, does not convert non-an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	197 → 446	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain-specific. {ECO:0000269|PubMed:9988767}.

Sequence

MARWPAPPPPPPPPPPLAAPPPPGASAKGPPARKLLFMCTLSLSVTYLCYSLLGGSGSLQ
FPLALQESPGAAAEPPPSPPPPSLLPTPVRLGAPSQPPAPPPLDNASHGEPPEPPEQPAA
PGTDGWGLPSGGGGAQDAWLRTPLAPSEMITAQSALPEREAQESSTTDEDLAGRRAANGS
SERGGAVSTPDYGEKKLPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFDRNYEKG
LEWYRNVMPKTLDGQITMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQ
TLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLSQILFVSGERL
IVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRI
DPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGDK

Sequence length

456

Interactions

View interactions

	Reactome
			HS-GAG biosynthesis

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Lymphoblastic leukemia	Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	30450575
Age-related macular degeneration	Age related macular degeneration	rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152 View all (20 more)	29346644

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Schizophrenia	Schizophrenia		GWAS
Diabetes	Diabetes		GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Dyslexia	Dyslexia		GWAS
Eosinophilia	Eosinophilia		GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	29547633, 30360368
Drug Related Side Effects and Adverse Reactions	Stimulate	34904858
Herpes Zoster	Associate	34904858
Neuralgia	Associate	34904858
Varicella Zoster Virus Infection	Associate	34904858

HS3ST4 (heparan sulfate-glucosamine 3-sulfotransferase 4)