Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9830
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM14
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and it
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025840 hsa-miR-7-5p Microarray 19073608
MIRT044852 hsa-miR-320a CLASH 23622248
MIRT646923 hsa-miR-21-3p HITS-CLIP 23824327
MIRT646922 hsa-miR-3591-3p HITS-CLIP 23824327
MIRT646921 hsa-miR-4640-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606556 16283 ENSG00000106785
Protein
UniProt ID Q14142
Protein name Tripartite motif-containing protein 14
Protein function Plays an essential role in the innate immune defense against viruses and bacteria (PubMed:30150992, PubMed:32404352). Promotes the 'Lys-48'-linked ubiquitination and subsequent degradation of hepatitis C virus NS5A leading to the inhibition of v
PDB 6JBM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00643 zf-B_box 21 61 B-box zinc finger Domain
PF13765 PRY 269 317 SPRY-associated domain Family
PF00622 SPRY 321 438 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in liver; undetectable in skeletal muscle.
Sequence
MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGL
A
LEAAVHVQKLSQECLKQLAIKKQQHIDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRVWSISQEPDPVQRLQA
YTATEQEMQQQMSLGELCHPVPLSFEPVKSFFKGLVEAVESTLQTPLDIRLKESINCQLS
DPSSTKPGTLLKTSPSPERSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV
PVLRFDALWQVLARDCF
ATGRHYWEVDVQEAGAGWWVGAAYASLRRRGASAAARLGCNRQ
SWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT
FQEPLYPALRLWEGAISI
PRLP
Sequence length 442
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 31070748, 33892646
Breast Neoplasms Stimulate 29562956
Breast Neoplasms Associate 33174608, 34787066
Carcinoma Non Small Cell Lung Stimulate 26599082
Carcinoma Non Small Cell Lung Associate 33174608
Fibrocartilaginous embolism Associate 31322007
Glioblastoma Associate 30728039
Glioma Associate 33316781
Inflammation Stimulate 31070748
Leukemia Myeloid Acute Associate 34656078