Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9817
Gene name Gene Name - the full gene name approved by the HGNC.	Kelch like ECH associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KEAP1
Synonyms (NCBI Gene) Gene synonyms aliases	INrf2, KLHL19
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is follow

Show/Hide all(93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006704	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21914820
MIRT006704	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21914820
MIRT025794	hsa-miR-7-5p	Sequencing	20371350
MIRT029595	hsa-miR-26b-5p	Microarray	19088304
MIRT040649	hsa-miR-92b-3p	CLASH	23622248
MIRT053761	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	24628843
MIRT053761	hsa-miR-141-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23045278
MIRT053761	hsa-miR-141-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23045278
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT025794	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	26453926
MIRT732785	hsa-miR-129-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	33569456
MIRT732785	hsa-miR-129-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	33569456
MIRT736293	hsa-miR-941	Western blotting, qRT-PCR	32102665
MIRT737548	hsa-miR-26b-3p	Western blotting, qRT-PCR	32104267
MIRT1085126	hsa-miR-1273f	CLIP-seq
MIRT1085127	hsa-miR-141	CLIP-seq
MIRT1085128	hsa-miR-143	CLIP-seq
MIRT1085129	hsa-miR-1827	CLIP-seq
MIRT1085130	hsa-miR-200a	CLIP-seq
MIRT1085131	hsa-miR-2110	CLIP-seq
MIRT1085132	hsa-miR-3065-5p	CLIP-seq
MIRT1085133	hsa-miR-3176	CLIP-seq
MIRT1085134	hsa-miR-3922-3p	CLIP-seq
MIRT1085135	hsa-miR-4271	CLIP-seq
MIRT1085136	hsa-miR-4287	CLIP-seq
MIRT1085137	hsa-miR-4649-3p	CLIP-seq
MIRT1085138	hsa-miR-4685-3p	CLIP-seq
MIRT1085139	hsa-miR-4708-5p	CLIP-seq
MIRT1085140	hsa-miR-4725-3p	CLIP-seq
MIRT1085141	hsa-miR-4757-5p	CLIP-seq
MIRT1085142	hsa-miR-4770	CLIP-seq
MIRT1085143	hsa-miR-4793-5p	CLIP-seq
MIRT1085144	hsa-miR-491-5p	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq
MIRT1085146	hsa-miR-616	CLIP-seq
MIRT1085131	hsa-miR-2110	CLIP-seq
MIRT1085132	hsa-miR-3065-5p	CLIP-seq
MIRT1085135	hsa-miR-4271	CLIP-seq
MIRT1085140	hsa-miR-4725-3p	CLIP-seq
MIRT1085144	hsa-miR-491-5p	CLIP-seq
MIRT2021691	hsa-miR-1269	CLIP-seq
MIRT2021692	hsa-miR-1269b	CLIP-seq
MIRT2021693	hsa-miR-2114	CLIP-seq
MIRT1085133	hsa-miR-3176	CLIP-seq
MIRT2021694	hsa-miR-3622b-5p	CLIP-seq
MIRT1085134	hsa-miR-3922-3p	CLIP-seq
MIRT2021695	hsa-miR-4283	CLIP-seq
MIRT1085136	hsa-miR-4287	CLIP-seq
MIRT2021696	hsa-miR-4304	CLIP-seq
MIRT2021697	hsa-miR-4426	CLIP-seq
MIRT2021698	hsa-miR-4449	CLIP-seq
MIRT2021699	hsa-miR-4508	CLIP-seq
MIRT2021700	hsa-miR-4520b-3p	CLIP-seq
MIRT2021701	hsa-miR-4529-3p	CLIP-seq
MIRT2021702	hsa-miR-4532	CLIP-seq
MIRT2021703	hsa-miR-4540	CLIP-seq
MIRT2021704	hsa-miR-4647	CLIP-seq
MIRT2021705	hsa-miR-4662b	CLIP-seq
MIRT1085138	hsa-miR-4685-3p	CLIP-seq
MIRT1085141	hsa-miR-4757-5p	CLIP-seq
MIRT2021706	hsa-miR-4783-3p	CLIP-seq
MIRT1085143	hsa-miR-4793-5p	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq
MIRT2021707	hsa-miR-512-3p	CLIP-seq
MIRT1085131	hsa-miR-2110	CLIP-seq
MIRT1085132	hsa-miR-3065-5p	CLIP-seq
MIRT1085135	hsa-miR-4271	CLIP-seq
MIRT1085140	hsa-miR-4725-3p	CLIP-seq
MIRT1085144	hsa-miR-491-5p	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq
MIRT2389716	hsa-miR-3148	CLIP-seq
MIRT2389717	hsa-miR-3189-3p	CLIP-seq
MIRT2389718	hsa-miR-3647-3p	CLIP-seq
MIRT2389719	hsa-miR-3978	CLIP-seq
MIRT2389720	hsa-miR-502-5p	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq
MIRT2556014	hsa-miR-2116	CLIP-seq
MIRT1085132	hsa-miR-3065-5p	CLIP-seq
MIRT2556015	hsa-miR-3117-5p	CLIP-seq
MIRT2389716	hsa-miR-3148	CLIP-seq
MIRT2389717	hsa-miR-3189-3p	CLIP-seq
MIRT2389718	hsa-miR-3647-3p	CLIP-seq
MIRT2389719	hsa-miR-3978	CLIP-seq
MIRT2556016	hsa-miR-4474-5p	CLIP-seq
MIRT2556017	hsa-miR-4677-5p	CLIP-seq
MIRT2556018	hsa-miR-4704-5p	CLIP-seq
MIRT2389720	hsa-miR-502-5p	CLIP-seq
MIRT1085145	hsa-miR-5095	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17015834
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	15601839, 16189514, 16888629, 17015834, 17510365, 18757741, 19424503, 19615732, 19706542, 20173742, 20452972, 20562859, 20600852, 21044950, 21145461, 21516116, 21903422, 21988832, 23274085, 24089205, 25416956, 25684205, 25910212, 26517842, 29792731, 30190310, 31169361, 31262713, 315
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15601839, 19424503
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS	17015834
GO:0005884	Component	Actin filament	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	15572695, 15601839
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IDA	36075446
GO:0010506	Process	Regulation of autophagy	IDA	20452972
GO:0010506	Process	Regulation of autophagy	IEA
GO:0016234	Component	Inclusion body	IDA	20452972
GO:0016234	Component	Inclusion body	IEA
GO:0016567	Process	Protein ubiquitination	IDA	15601839, 15983046
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030496	Component	Midbody	IDA	15166316
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IBA
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	15601839, 15983046
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	17015834
GO:0032991	Component	Protein-containing complex	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0034599	Process	Cellular response to oxidative stress	IDA	36075446
GO:0034599	Process	Cellular response to oxidative stress	IDA	15601839
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15601839
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15601839
GO:0045604	Process	Regulation of epidermal cell differentiation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	17015834
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29658272
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	17015834
GO:1902883	Process	Negative regulation of response to oxidative stress	IDA	11027288
GO:1902883	Process	Negative regulation of response to oxidative stress	IDA	15601839
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	15572695, 15601839

MIM	HGNC	e!Ensembl
606016	23177	ENSG00000079999

Protein

UniProt ID

Q14145

Protein name

Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) (INrf2) (Kelch-like protein 19)

Protein function

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that regulates the response to oxidative stress by targeting NFE2L2/NRF2 for ubiquitination (PubMed:14585973, PubMed:15379550, PubMed:15572695, PubMed:15601839, PubM

PDB

1U6D , 1ZGK , 2FLU , 3VNG , 3VNH , 3ZGC , 3ZGD , 4CXI , 4CXJ , 4CXT , 4IFJ , 4IFL , 4IFN , 4IN4 , 4IQK , 4L7B , 4L7C , 4L7D , 4N1B , 4XMB , 5DAD , 5DAF , 5F72 , 5GIT , 5NLB , 5WFL , 5WFV , 5WG1 , 5WHL , 5WHO , 5WIY , 5X54 , 6FFM , 6FMP , 6FMQ , 6HWS , 6LRZ , 6ROG , 6SP1 , 6SP4 , 6T7V , 6T7Z , 6TG8 , 6TYM , 6TYP , 6UF0 , 6V6Z , 6W66 , 6W67 , 6W68 , 6W69

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	67 → 179	BTB/POZ domain	Domain
PF07707	BACK	184 → 286	BTB And C-terminal Kelch	Domain
PF01344	Kelch_1	318 → 359	Kelch motif	Repeat
PF01344	Kelch_1	361 → 410	Kelch motif	Repeat
PF01344	Kelch_1	412 → 457	Kelch motif	Repeat
PF01344	Kelch_1	459 → 504	Kelch motif	Repeat
PF01344	Kelch_1	506 → 551	Kelch motif	Repeat
PF01344	Kelch_1	553 → 598	Kelch motif	Repeat

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed, with highest levels in skeletal muscle. {ECO:0000269|PubMed:15379550}.

Sequence

MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC

Sequence length

624

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Parkinson disease Pathways in cancer Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Ub-specific processing proteases Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Carcinoma Of The Head And Neck	squamous cell carcinoma of the head and neck	N/A	N/A	ClinVar
Hepatocellular Carcinoma	Hepatocellular carcinoma		31903165, 35380342	CBGDA
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS
Lung adenocarcinoma	Lung adenocarcinoma	We show that loss of Keap1 hyperactivates NRF2 and promotes KRAS-driven LUAD in mice.	28967920	CBGDA
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Sertoli-Leydig Cell Tumor	goiter, multinodular 1, with or without Sertoli-Leydig cell tumors	N/A	N/A	GenCC

Show/Hide Text Mining Associations (124)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Lung Injury	Associate	35910848, 36913799
Adenocarcinoma	Associate	31159323, 31988001, 38184997
Adenocarcinoma of Lung	Associate	25878335, 26069186, 28336552, 30075702, 32327612, 32445554, 32866624, 33229301, 33264619, 33299528, 34275893, 34328274, 34450259, 34617407, 34740862 View all (6 more)
Adenocarcinoma Papillary	Associate	21248763
Adenoma Pleomorphic	Associate	25928388
Alzheimer Disease	Associate	24450635
Anxiety	Associate	35917404
Arthritis Rheumatoid	Associate	36814154
Brain Diseases	Associate	34952628
Breast Neoplasms	Associate	21489257, 21926171, 23249627, 25827424, 25976679, 26657794, 27323010, 28416489, 30803422, 39264897
Calcinosis	Associate	31316111
Carcinogenesis	Associate	25505069, 26350055, 26497117, 29306329, 30803422, 33123313, 33754045, 37401495, 37688978
Carcinogenesis	Inhibit	30195190
Carcinoid Tumor	Associate	31126053, 31159323
Carcinoma Adenoid Cystic	Associate	26350055, 35524269
Carcinoma Endometrioid	Associate	21897267
Carcinoma Hepatocellular	Associate	23728943, 25896253, 27650414, 30042301, 30119680, 33162398, 35592903, 36419136, 38251077
Carcinoma Large Cell	Associate	26960398, 29535388, 33031101, 35287068, 35331190
Carcinoma Non Small Cell Lung	Associate	17020408, 19345732, 20534738, 22684020, 26711467, 26960398, 27029077, 27552339, 27601007, 28965760, 30896962, 31455821, 31884422, 32272498, 32312757 View all (18 more)
Carcinoma Ovarian Epithelial	Associate	26191276
Carcinoma Pancreatic Ductal	Associate	26497117
Carcinoma Renal Cell	Associate	25564569, 28061437, 30896860
Carcinoma Squamous Cell	Associate	20534738, 23451093, 24322982, 24323028, 28177435, 30058679, 31221127, 31299995, 32272498, 32434476, 33229301, 35351670, 36453575
Carcinoma Squamous Cell	Inhibit	26247201
Cataract	Associate	24525405
Colonic Neoplasms	Associate	19706542
Colorectal Neoplasms	Associate	22279539, 22325485, 23766854, 36038548, 37075346
COVID 19	Associate	36571271, 36613859
Death	Associate	33264619
Diabetes Mellitus	Associate	24450635, 25674242, 34861061
Diabetes Mellitus Type 2	Associate	34861061
Diabetic Cardiomyopathies	Associate	25674242
Diabetic Neuropathies	Associate	34861061
Diabetic Retinopathy	Associate	34861061
Disease	Associate	35038823
Disease Resistance	Associate	35157996
Drug Related Side Effects and Adverse Reactions	Associate	20495340, 26453926
Early Onset Glaucoma	Associate	33264619
Endometrial Neoplasms	Associate	21897267, 30908539
Epiretinal Membrane	Associate	36567907
Epstein Barr Virus Infections	Stimulate	35105963
Esophageal Neoplasms	Associate	26341629
Esophageal Squamous Cell Carcinoma	Associate	26341629, 28760781, 29675925, 31755241
Fibrocartilaginous embolism	Associate	33603950
Focal cortical dysplasia of Taylor	Associate	35112146
Frontotemporal Lobar Degeneration	Associate	27554286
Gallbladder Neoplasms	Associate	32839463
Genomic Instability	Associate	36044718
Glioblastoma	Associate	40684395
Glioma	Associate	21173573
Goiter	Associate	23724128
Goiter Multinodular 2	Associate	23724128
Head and Neck Neoplasms	Associate	27638861
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23249627
Heredodegenerative Disorders Nervous System	Associate	34526504
Hyperglycemia	Associate	32369110
Hypertensive Retinopathy	Associate	34861061
Inflammation	Associate	28678311, 29927029, 32434476, 34212035, 34252790
Insulin Resistance	Associate	30466006
Intervertebral Disc Degeneration	Associate	36814575
Kidney Diseases	Associate	28061437
Kidney Neoplasms	Associate	28061437
Laryngeal Neoplasms	Associate	27840932
Leukemia	Associate	26870816
Leukemia Lymphocytic Chronic B Cell	Associate	20368435
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	40565143
Liver Cirrhosis Biliary	Associate	28333129
Liver Failure	Associate	30466006
Lung Diseases	Associate	36613859
Lung Injury	Associate	35847598
Lung Neoplasms	Associate	17020408, 21795997, 28145866, 29089357, 29474635, 31126053, 31159323, 32327612, 32571982, 33071215, 33139492, 33264619, 34065616, 34740862, 34952628 View all (6 more)
Lymphatic Metastasis	Associate	27323010, 34761587
Lymphoma Large B Cell Diffuse	Associate	30755497
Melanoma	Associate	27045471
Memory Disorders	Associate	35917404
Microsatellite Instability	Associate	37838086
Multiple Sclerosis	Associate	32241259, 36571271
Myocarditis	Associate	36128875
Myotonic Dystrophy	Associate	34450259
Neoplasm Metastasis	Associate	26657794, 29474635, 32374727, 34952628, 39673828
Neoplasms	Associate	15883370, 17020408, 18413364, 18757741, 21173573, 21248763, 22089114, 22325485, 22960745, 23672216, 24322982, 25582950, 26191276, 26208877, 26247201 View all (66 more)
Neoplasms	Inhibit	20073072, 26657794, 32327612, 38268163
Neoplasms Cystic Mucinous and Serous	Associate	26191276
Neoplasms Squamous Cell	Associate	22960745, 32571982
Nervous System Diseases	Associate	34861061
Neuralgia	Associate	34861061
Neuroblastoma	Associate	36436316
Neurodegenerative Diseases	Associate	27554286, 29927029
Neuroendocrine Tumors	Associate	33031101
Neuroinflammatory Diseases	Associate	34252790
Obesity	Associate	34861061
Oropharyngeal Neoplasms	Associate	26932277
Osteoglophonic dwarfism	Associate	36193504, 40289338
Osteosarcoma	Associate	36965071
Ovarian Neoplasms	Associate	25114896
Pancreatic Neoplasms	Associate	21489257, 25879528, 26497117, 27756327, 31785531, 33446568
Parkinson Disease	Associate	16092930, 24450635, 29927029, 37947628
Pre Eclampsia	Inhibit	33725925
Pre Eclampsia	Associate	35216082
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25323587
Progeria	Associate	28229933
Prostatic Neoplasms	Associate	33356808
Pulmonary Disease Chronic Obstructive	Associate	29506519, 29927029
Rectal Neoplasms	Associate	37401495
Reperfusion Injury	Associate	31669760
Retinitis	Associate	31669760
Retrograde Degeneration	Associate	35917404
Rufous oculocutaneous albinism	Associate	35301413
Sepsis	Associate	36913799
Small Cell Lung Carcinoma	Associate	31199602, 35287068, 36044718
Squamous Cell Carcinoma of Head and Neck	Associate	23451093, 24386210, 27840932, 29053175, 29306329, 33087706, 34212035, 35945195
Stomach Neoplasms	Associate	30811526, 34098867, 35237380
Tertiary Lymphoid Structures	Inhibit	26247201
Thyroid Cancer Papillary	Associate	24138990
Thyroid Neoplasms	Associate	24138990
Triple Negative Breast Neoplasms	Associate	23249627, 37380368
Turcot syndrome	Associate	37838086
Urinary Bladder Neoplasms	Associate	37108769
Uterine Cervical Dysplasia	Inhibit	26247201
Uterine Cervical Neoplasms	Associate	26247201, 30058679
Uterine Cervical Neoplasms	Inhibit	34761587
Uterine Diseases	Associate	37773689
Vitiligo	Associate	40723924
Wounds and Injuries	Associate	34761008, 37773689

KEAP1 (kelch like ECH associated protein 1)