Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9806
Gene name Gene Name - the full gene name approved by the HGNC.
SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPOCK2
Synonyms (NCBI Gene) Gene synonyms aliases
testican-2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein which binds with glycosaminoglycans to form part of the extracellular matrix. The protein contains thyroglobulin type-1, follistatin-like, and calcium-binding domains, and has glycosaminoglycan attachment sites in the acidic C-
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT622130 hsa-miR-8485 HITS-CLIP 23824327
MIRT622129 hsa-miR-603 HITS-CLIP 23824327
MIRT622128 hsa-miR-4789-3p HITS-CLIP 23824327
MIRT622127 hsa-miR-4643 HITS-CLIP 23824327
MIRT622126 hsa-miR-3941 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IDA 10386950
GO:0005515 Function Protein binding IPI 32296183
GO:0005539 Function Glycosaminoglycan binding IEA
GO:0007416 Process Synapse assembly NAS 10386950
GO:0008191 Function Metalloendopeptidase inhibitor activity TAS 12810672
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607988 13564 ENSG00000107742
Protein
UniProt ID Q92563
Protein name Testican-2 (SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2)
Protein function May participate in diverse steps of neurogenesis. Binds calcium.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07648 Kazal_2 131 180 Kazal-type serine protease inhibitor domain Domain
PF10591 SPARC_Ca_bdg 196 305 Secreted protein acidic and rich in cysteine Ca binding region Domain
PF00086 Thyroglobulin_1 313 376 Thyroglobulin type-1 repeat Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain. Also found in lung and testis. {ECO:0000269|PubMed:10386950}.
Sequence
MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC
PCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDK
SLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFC
FWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQ
LGLELTGTRTHGSPDC
DDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG
GYIW
Sequence length 424
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 36629984
Airway Remodeling Associate 37165378
Back Pain Associate 30747904
Breast Neoplasms Associate 18446232
Carcinoma Pancreatic Ductal Associate 33761652
Carcinoma Pancreatic Ductal Inhibit 37188984
Colorectal Neoplasms Associate 18446232
Endometriosis Associate 32851893
Inflammation Associate 21470430
Lupus Erythematosus Systemic Associate 37841281