Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9781
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 144A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF144A
Synonyms (NCBI Gene) Gene synonyms aliases
RNF144, UBCE7IP4, UIP4, hUIP4
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004988 hsa-miR-125b-5p Microarray 17891175
MIRT019138 hsa-miR-335-5p Microarray 18185580
MIRT030321 hsa-miR-26b-5p Microarray 19088304
MIRT030564 hsa-miR-24-3p Microarray 19748357
MIRT1310370 hsa-miR-1262 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
MTA1 Repression 22184113
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA
GO:0002221 Process Pattern recognition receptor signaling pathway IDA 23910378
GO:0002221 Process Pattern recognition receptor signaling pathway IDA 37955227
GO:0002753 Process Cytoplasmic pattern recognition receptor signaling pathway IDA 29441066
GO:0004842 Function Ubiquitin-protein transferase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619454 20457 ENSG00000151692
Protein
UniProt ID P50876
Protein name E3 ubiquitin-protein ligase RNF144A (EC 2.3.2.31) (RING finger protein 144A) (UbcM4-interacting protein 4) (Ubiquitin-conjugating enzyme 7-interacting protein 4)
Protein function E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:26216882). Mediates the ubiquitinatio
PDB 1WIM , 6L99
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01485 IBR 91 156 IBR domain, a half RING-finger domain Domain
PF01485 IBR 168 232 IBR domain, a half RING-finger domain Domain
Sequence
MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLE
TAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
QLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGC
PETMPITFLPGETSAAFKMEEDDA
PIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPC
RNKLGHSR
ASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Sequence length 292
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    E3 ubiquitin ligases ubiquitinate target proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 31280115
Breast Neoplasms Associate 29473320
Breast Neoplasms Inhibit 35103856
Endometrial Neoplasms Inhibit 39465767
Neoplasms Inhibit 29473320, 35103856
Neoplasms Associate 34440306
Osteosarcoma Associate 34440306
Squamous Cell Carcinoma of Head and Neck Associate 31815689, 35361159
Urinary Bladder Neoplasms Associate 32047140