Gene Gene information from NCBI Gene database.
Entrez ID 9770
Gene name Ras association domain family member 2
Gene symbol RASSF2
Synonyms (NCBI Gene)
CENP-34RASFADIN
Chromosome 20
Chromosome location 20p13
Summary This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by Re
miRNA miRNA information provided by mirtarbase database.
226
miRTarBase ID miRNA Experiments Reference
MIRT016642 hsa-miR-429 Reporter assay 20005803
MIRT020352 hsa-miR-200a-3p Reporter assay 20005803
MIRT021074 hsa-miR-200c-3p Reporter assay 20005803
MIRT021654 hsa-miR-141-3p Reporter assay 20005803
MIRT022828 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 20813266
GO:0000776 Component Kinetochore IEA
GO:0001501 Process Skeletal system development IEA
GO:0001503 Process Ossification IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609492 9883 ENSG00000101265
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50749
Protein name Ras association domain-containing protein 2
Protein function Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest. Stabilizes STK3/MST2 by protecting it from proteasomal degradation. {ECO:0000269|PubMed:12732644, ECO:0000269|PubMed:16012945, ECO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 176 264 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 277 316 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines. {ECO:0000269|PubMed:12732644}.
Sequence
MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
PLIARILQGPCEQISKVFLMEKDQ
VEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRL
EEIAETPATI
Sequence length 326
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Hippo signaling pathway - multiple species