Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9770
Gene name Gene Name - the full gene name approved by the HGNC.
Ras association domain family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RASSF2
Synonyms (NCBI Gene) Gene synonyms aliases
CENP-34, RASFADIN
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by Re
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016642 hsa-miR-429 Reporter assay 20005803
MIRT020352 hsa-miR-200a-3p Reporter assay 20005803
MIRT021074 hsa-miR-200c-3p Reporter assay 20005803
MIRT021654 hsa-miR-141-3p Reporter assay 20005803
MIRT022828 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000776 Component Kinetochore IDA 20813266
GO:0000777 Component Condensed chromosome kinetochore IEA
GO:0001501 Process Skeletal system development IEA
GO:0001503 Process Ossification IEA
GO:0004672 Function Protein kinase activity IGI 19962960
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609492 9883 ENSG00000101265
Protein
UniProt ID P50749
Protein name Ras association domain-containing protein 2
Protein function Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest. Stabilizes STK3/MST2 by protecting it from proteasomal degradation. {ECO:0000269|PubMed:12732644, ECO:0000269|PubMed:16012945, ECO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 176 264 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 277 316 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines. {ECO:0000269|PubMed:12732644}.
Sequence
MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
PLIARILQGPCEQISKVFLMEKDQ
VEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRL
EEIAETPATI
Sequence length 326
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Hippo signaling pathway - multiple species  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Unknown
Disease term Disease name Evidence References Source
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Dementia Dementia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenoma Associate 17923875, 19700653
Brain Neoplasms Associate 25482183
Breast Neoplasms Associate 23542458, 25482183, 26284587
Breast Neoplasms Stimulate 34180753
Carcinogenesis Associate 19700653, 20920251
Carcinoma Hepatocellular Associate 18161048
Colorectal Neoplasms Associate 19700653
Diabetes Mellitus Type 2 Associate 34560403
Fibrosis Associate 35222428
Gastrointestinal Neoplasms Associate 19700653