ADGRE5 (adhesion G protein-coupled receptor E5)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
976
Gene name Gene Name - the full gene name approved by the HGNC.
Adhesion G protein-coupled receptor E5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADGRE5
Synonyms (NCBI Gene) Gene synonyms aliases
CD97, TM7LN1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane sub
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT438175 hsa-miR-126-3p FACS, Flow, GFP reporter assay, Luciferase reporter assay, qRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACS, Flow, GFP reporter assay, Luciferase reporter assay, qRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACS, Flow, GFP reporter assay, Luciferase reporter assay, qRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACS, Flow, GFP reporter assay, Luciferase reporter assay, qRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACS, Flow, GFP reporter assay, Luciferase reporter assay, qRT-PCR 24274104
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(3)
Transcription factor Regulation Reference
SP1 Activation 18329191
SP3 Activation 18329191
WT1 Activation 22313360
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 7636245
GO:0004930 Function G protein-coupled receptor activity IBA 21873635
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 9064337, 22210915
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
601211 1711 ENSG00000123146
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID P48960
Protein name Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta]
Protein function Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
PDB 2BOU , 7DO4 , 7YDH , 7YDJ , 7YDM , 7YDP , 8IKJ , 8IKL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA 64 → 114 Calcium-binding EGF domain Domain
PF07645 EGF_CA 116 → 158 Calcium-binding EGF domain Domain
PF07645 EGF_CA 160 → 207 Calcium-binding EGF domain Domain
PF07645 EGF_CA 209 → 256 Calcium-binding EGF domain Domain
PF01825 GPS 493 → 536 GPCR proteolysis site, GPS, motif Motif
PF00002 7tm_2 544 → 782 7 transmembrane receptor (Secretin family) Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastr
Sequence 
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
Sequence length 835
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  Reactome
    Class B/2 (Secretin family receptors)
Neutrophil degranulation