ADGRE5 (adhesion G protein-coupled receptor E5)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 976
Gene name Adhesion G protein-coupled receptor E5
Gene symbol ADGRE5
Synonyms (NCBI Gene)
CD97TM7LN1
Chromosome 19
Chromosome location 19p13.12
Summary This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane sub
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
MIRT438175 hsa-miR-126-3p FACSFlowGFP reporter assayLuciferase reporter assayqRT-PCR 24274104
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
SP1 Activation 18329191
SP3 Activation 18329191
WT1 Activation 22313360
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (28)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 7636245
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601211 1711 ENSG00000123146
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P48960
Protein name Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta]
Protein function Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
PDB 2BOU , 7DO4 , 7YDH , 7YDJ , 7YDM , 7YDP , 8IKJ , 8IKL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA 64 → 114 Calcium-binding EGF domain Domain
PF07645 EGF_CA 116 → 158 Calcium-binding EGF domain Domain
PF07645 EGF_CA 160 → 207 Calcium-binding EGF domain Domain
PF07645 EGF_CA 209 → 256 Calcium-binding EGF domain Domain
PF01825 GPS 493 → 536 GPCR proteolysis site, GPS, motif Motif
PF00002 7tm_2 544 → 782 7 transmembrane receptor (Secretin family) Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastr
Sequence 
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
Sequence length 835
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Class B/2 (Secretin family receptors)
Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
9
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (9)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Likely benign rs146888178 RCV005902764
Clear cell carcinoma of kidney Likely benign rs146888178 RCV005902765
Colon adenocarcinoma Likely benign rs146888178 RCV005902763
Lung cancer Likely benign rs146888178 RCV005902770
Show/Hide Text Mining Associations (35)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 15693006, 33992645
Brain Neoplasms Associate 25714433
Burkitt Lymphoma Associate 30953469
Carcinoma Hepatocellular Associate 36464675
Carcinoma Signet Ring Cell Associate 16130195
Cholangiocarcinoma Associate 28345461
Colorectal Neoplasms Associate 12414513, 26462154
Fibrosis Associate 29952218
Gallbladder Neoplasms Associate 22547928
Glioblastoma Associate 23658650, 25714433, 35087132