HDAC9 (histone deacetylase 9)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9734
Gene name Histone deacetylase 9
Gene symbol HDAC9
Synonyms (NCBI Gene)
ARCND4HD7HD7bHD9HDACHDAC7HDAC7BHDAC9BHDAC9FLHDRPMITR
Chromosome 7
Chromosome location 7p21.1
Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene h
miRNA miRNA information provided by mirtarbase database.
41
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (41)
miRTarBase ID miRNA Experiments Reference
MIRT610224 hsa-miR-8485 HITS-CLIP 23824327
MIRT610224 hsa-miR-8485 HITS-CLIP 23824327
MIRT610223 hsa-miR-342-3p HITS-CLIP 23824327
MIRT731680 hsa-miR-29a-5p Luciferase reporter assayWestern blot 26441331
MIRT731680 hsa-miR-29a-5p Luciferase reporter assayWestern blot 26441331
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
GATA4 Repression 18332107
SALL3 Repression 18332107
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
52
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (52)
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IBA
GO:0000118 Component Histone deacetylase complex TAS 12711221
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10655483
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11535832
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606543 14065 ENSG00000048052
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKV0
Protein name Histone deacetylase 9 (HD9) (EC 3.5.1.98) (Histone deacetylase 7B) (HD7) (HD7b) (Histone deacetylase-related protein) (MEF2-interacting transcription repressor MITR)
Protein function Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell c
PDB 8Q9N , 8Q9R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12203 HDAC4_Gln 37 → 124 Glutamine rich N terminal domain of histone deacetylase 4 Family
PF00850 Hist_deacetyl 654 → 972 Histone deacetylase domain Domain
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level). {ECO:0000269|PubMed:10655483, ECO:0000269|PubMed:11535832, ECO:0000269|PubMed:12590135
Sequence 
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS
Sequence length 1011
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis 		  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs188666461 RCV005902710
Colon adenocarcinoma Benign rs188666461 RCV005902709
Lung cancer Uncertain significance rs765164988 RCV005932312
Malignant tumor of esophagus Uncertain significance rs374343180 RCV005932315
Show/Hide Text Mining Associations (259)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Pain Inhibit 36803776
Acne Vulgaris Associate 30737272
Acute Coronary Syndrome Associate 27642596
Adenocarcinoma Inhibit 24427341
Adenocarcinoma Associate 25923331
Adenocarcinoma of Lung Associate 24427341, 24650256, 24830600, 36991099
Adenoma Associate 23677573, 36343387
Alopecia Associate 26001114
alpha 1 Antitrypsin Deficiency Associate 22995909
Alzheimer Disease Associate 20221449, 24005853, 24200051, 29458411, 36039594