Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9709
Gene name Gene Name - the full gene name approved by the HGNC.
Homocysteine inducible ER protein with ubiquitin like domain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HERPUD1
Synonyms (NCBI Gene) Gene synonyms aliases
HERP, HERPUD1-IT1, Mif1, SUP
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q13
Summary Summary of gene provided in NCBI Entrez Gene.
The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involv
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002508 hsa-miR-373-3p Microarray 15685193
MIRT018664 hsa-miR-335-5p Microarray 18185580
MIRT019938 hsa-miR-375 Microarray 20215506
MIRT002508 hsa-miR-373-3p Microarray;Other 15685193
MIRT029926 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 18307982, 28827405
GO:0005783 Component Endoplasmic reticulum IDA 15102845, 19788048, 22045699
GO:0005789 Component Endoplasmic reticulum membrane IBA 21873635
GO:0005789 Component Endoplasmic reticulum membrane IDA 10922362
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608070 13744 ENSG00000051108
Protein
UniProt ID Q15011
Protein name Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (Methyl methanesulfonate (MMF)-inducible fragment protein 1)
Protein function Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins (PubMed:16289116, PubMed:28827405). Could e
PDB 1WGD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 12 89 Ubiquitin family Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed; in the brain, expression seems to be restricted to neurons and vascular smooth muscle cells. Present in activated microglia in senile plaques in the brain of patients with Alzheimer disease.
Sequence
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG
KLLLDHQCLRDLLPKQEKRHVLHLVCNVK
SPSKMPEINAKVAESTEEPAGSNRGQYPEDS
SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA
NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE
QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN
Sequence length 391
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein processing in endoplasmic reticulum   ATF4 activates genes in response to endoplasmic reticulum stress
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Coronary artery disease Coronary artery disease GWAS
Exudative Macular Degeneration Exudative Macular Degeneration GWAS
Macular Degeneration Macular Degeneration GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37072786
alpha 1 Antitrypsin Deficiency Associate 28617828
Autoimmune Diseases Associate 29207374
Carcinogenesis Associate 21503571
Chemical and Drug Induced Liver Injury Associate 28617828
Cholestasis Associate 28617828
Drug Related Side Effects and Adverse Reactions Associate 16441512
Endometrial Neoplasms Associate 31718641
Glioma Associate 28430789
HELLP Syndrome Associate 28617828