Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9636
Gene name Gene Name - the full gene name approved by the HGNC.	ISG15 ubiquitin like modifier
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ISG15
Synonyms (NCBI Gene) Gene synonyms aliases	G1P2, IFI15, IMD38, IP17, UCRP, hUCRP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic ac

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs672601312	G>A,T	Uncertain-significance, pathogenic	Stop gained, coding sequence variant, missense variant
rs672601345	->G	Pathogenic	Coding sequence variant, frameshift variant
rs786201005	C>T	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021235	hsa-miR-146a-5p	Microarray	18057241
MIRT023954	hsa-miR-1-3p	Microarray	18668037

Show/Hide all(50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005178	Function	Integrin binding	IPI	29100055
GO:0005515	Function	Protein binding	IPI	16189514, 16872604, 17597759, 18305167, 19270716, 20133869, 21245344, 21266548, 21808041, 25307056, 25416956, 28438633, 28514442, 28931677, 30644842, 31515488, 31765674, 32296183, 32428392, 32726803, 32814053, 32845033, 33727702, 33961781, 34270554, 34663977
GO:0005576	Component	Extracellular region	IDA	22859821
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	24257616
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	29100055
GO:0009615	Process	Response to virus	IDA	33727702
GO:0009615	Process	Response to virus	IEP	28724761
GO:0009617	Process	Response to bacterium	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0019941	Process	Modification-dependent protein catabolic process	IBA
GO:0019941	Process	Modification-dependent protein catabolic process	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031386	Function	Protein tag activity	IBA
GO:0031386	Function	Protein tag activity	IDA	16407192
GO:0031386	Function	Protein tag activity	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	18305167
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0032020	Process	ISG15-protein conjugation	IBA
GO:0032020	Process	ISG15-protein conjugation	IDA	16122702, 16407192, 21543490, 33727702
GO:0032020	Process	ISG15-protein conjugation	IEA
GO:0032020	Process	ISG15-protein conjugation	IEA
GO:0032020	Process	ISG15-protein conjugation	IMP	22859821
GO:0032461	Process	Positive regulation of protein oligomerization	IDA	33727702
GO:0032649	Process	Regulation of type II interferon production	IMP	22859821
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	33727702
GO:0032729	Process	Positive regulation of type II interferon production	IDA	29100055
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	29100055
GO:0034340	Process	Response to type I interferon	IDA	22859821
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IMP	22859821
GO:0045071	Process	Negative regulation of viral genome replication	IDA	33727702
GO:0045071	Process	Negative regulation of viral genome replication	IMP	19357168
GO:0045087	Process	Innate immune response	IDA	28724761
GO:0045087	Process	Innate immune response	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051607	Process	Defense response to virus	IDA	33727702
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	19357168
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	28724761
GO:0070585	Process	Protein localization to mitochondrion	IDA	33727702

MIM	HGNC	e!Ensembl
147571	4053	ENSG00000187608

Protein

UniProt ID

P05161

Protein name

Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) (hUCRP)

Protein function

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein (PubMed:27564865, PubMed:39465252). IS

PDB

1Z2M , 2HJ8 , 3PHX , 3PSE , 3R66 , 3RT3 , 3SDL , 5TL6 , 5W8T , 5W8U , 6BI8 , 6FFA , 6XA9 , 7RBS , 7S6P , 8OIF , 8SE9 , 8SEA , 8SEB , 8SV8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	5 → 78	Ubiquitin family	Domain
PF00240	ubiquitin	84 → 155	Ubiquitin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons. Expressed in neutrophils, monocytes and lymphocytes. Enhanced expression seen in pancreatic adenocarcinoma, endometrial cancer, and bladder cancer,

Sequence

MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Sequence length

165

Interactions

View interactions

	KEGG		Reactome
	RIG-I-like receptor signaling pathway Human papillomavirus infection Epstein-Barr virus infection Coronavirus disease - COVID-19		ISG15 antiviral mechanism NS1 Mediated Effects on Host Pathways DDX58/IFIH1-mediated induction of interferon-alpha/beta Termination of translesion DNA synthesis Interferon alpha/beta signaling Negative regulators of DDX58/IFIH1 signaling

ISG15 (ISG15 ubiquitin like modifier)