Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	963
Gene name Gene Name - the full gene name approved by the HGNC.	CD53 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD53
Synonyms (NCBI Gene) Gene synonyms aliases	MOX44, TSPAN25
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments
MIRT875813	hsa-miR-1264	CLIP-seq
MIRT875814	hsa-miR-361-5p	CLIP-seq
MIRT875815	hsa-miR-4318	CLIP-seq
MIRT875816	hsa-miR-4679	CLIP-seq
MIRT875817	hsa-miR-4693-5p	CLIP-seq
MIRT875818	hsa-miR-4778-3p	CLIP-seq
MIRT875819	hsa-miR-550b	CLIP-seq
MIRT875820	hsa-miR-892a	CLIP-seq
MIRT1959660	hsa-miR-203	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IDA	21930792
GO:0005515	Function	Protein binding	IPI	21930792, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28487417
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8436422
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	ISS
GO:0007165	Process	Signal transduction	NAS	8404042
GO:0016020	Component	Membrane	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043113	Process	Receptor clustering	IDA	35767951
GO:0043495	Function	Protein-membrane adaptor activity	IDA	35767951
GO:0045202	Component	Synapse	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	10358156, 35271814
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070161	Component	Anchoring junction	IEA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	ISS

MIM	HGNC	e!Ensembl
151525	1686	ENSG00000143119

Protein

UniProt ID

P19397

Protein name

Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed:28487417). Participates thereby in diverse biological functions su

PDB

6WVG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	9 → 209	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells. {ECO:0000269|PubMed:8335905}.

Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVG
SIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTD
SIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
NFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Sequence length

219

Interactions

View interactions

	Reactome
			Neutrophil degranulation

CD53 (CD53 molecule)