Gene Gene information from NCBI Gene database.
Entrez ID 9616
Gene name Ring finger protein 7
Gene symbol RNF7
Synonyms (NCBI Gene)
CKBBP1ROC2SAGrbx2
Chromosome 3
Chromosome location 3q23
Summary The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and sig
miRNA miRNA information provided by mirtarbase database.
386
miRTarBase ID miRNA Experiments Reference
MIRT019231 hsa-miR-331-3p Sequencing 20371350
MIRT439146 hsa-let-7c-5p 3'LIFE 25074381
MIRT439146 hsa-let-7c-5p 3'LIFE 25074381
MIRT1313647 hsa-miR-1183 CLIP-seq
MIRT1313648 hsa-miR-1293 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
NR4A1 Repression 22159226
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
62
GO ID Ontology Definition Evidence Reference
GO:0001837 Process Epithelial to mesenchymal transition IDA 16096638
GO:0005507 Function Copper ion binding TAS 10082581
GO:0005515 Function Protein binding IPI 16325183, 19250909, 20098747, 21145461, 21516116, 22190034, 25416956, 26030842, 26906416, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 16874460
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603863 10070 ENSG00000114125
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBF6
Protein name RING-box protein 2 (Rbx2) (EC 2.3.2.27) (EC 2.3.2.32) (CKII beta-binding protein 1) (CKBBP1) (RING finger protein 7) (Regulator of cullins 2) (Sensitive to apoptosis gene protein)
Protein function Catalytic component of multiple cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:21980433, PubMed:33268465, PubMed:38418882, P
PDB 2ECL , 7ONI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12678 zf-rbx1 48 103 RING-H2 zinc finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. {ECO:0000269|PubMed:10512750}.
Sequence
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQ
QDWVVQRIGK
Sequence length 113
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ubiquitin mediated proteolysis
Human immunodeficiency virus 1 infection
  Neddylation
Antigen processing: Ubiquitination & Proteasome degradation