Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	959
Gene name	CD40 ligand
Gene symbol	CD40LG
Synonyms (NCBI Gene)	CD154CD40LHIGM1IGMIMD3T-BAMTNFSF5TRAPgp39hCD40L
Chromosome	X
Chromosome location	Xq26.3
Summary	The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper

Show/Hide all (37)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894768	G>T	Pathogenic	Coding sequence variant, missense variant
rs104894769	T>A,C	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs104894771	G>C	Pathogenic	Coding sequence variant, missense variant
rs104894772	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894773	T>A,C	Likely-benign, pathogenic	Coding sequence variant, synonymous variant, missense variant
rs104894774	T>A,G	Likely-pathogenic	Coding sequence variant, missense variant
rs104894775	G>A	Pathogenic	Coding sequence variant, stop gained
rs104894777	T>G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs104894778	C>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs193922134	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs193922135	C>T	Pathogenic	Coding sequence variant, stop gained
rs193922136	C>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs368003929	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs786205606	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs786205607	AT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs886039326	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs886041747	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057518628	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1057521127	C>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1057521128	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1085307733	C>T	Pathogenic	Coding sequence variant, stop gained
rs1387503550	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs1556136635	C>A	Pathogenic	Stop gained, coding sequence variant
rs1556139575	G>-	Pathogenic	Coding sequence variant, splice donor variant
rs1556143529	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1569376229	G>A	Likely-pathogenic	Splice donor variant
rs1569376925	AAAGAGGAGAC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1569376930	GAAA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1569377237	A>G	Pathogenic	Splice acceptor variant
rs1569377829	C>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1569377865	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1603319726	CA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603321138	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1603321154	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603321772	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1603321834	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1603321840	G>A	Likely-pathogenic	Coding sequence variant, missense variant

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005463	hsa-miR-146a-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	21236257
MIRT663024	hsa-miR-5681a	HITS-CLIP	23824327
MIRT663023	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT663022	hsa-miR-3152-3p	HITS-CLIP	23824327
MIRT663021	hsa-miR-4455	HITS-CLIP	23824327
MIRT663020	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619130	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619129	hsa-miR-4499	HITS-CLIP	23824327
MIRT619128	hsa-miR-9500	HITS-CLIP	23824327
MIRT619127	hsa-miR-637	HITS-CLIP	23824327
MIRT619126	hsa-miR-4513	HITS-CLIP	23824327
MIRT619125	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT619124	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT619123	hsa-miR-6077	HITS-CLIP	23824327
MIRT619122	hsa-miR-1249-5p	HITS-CLIP	23824327
MIRT619121	hsa-miR-6797-5p	HITS-CLIP	23824327
MIRT619120	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT619119	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT619118	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT619117	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT619116	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT619115	hsa-miR-625-5p	HITS-CLIP	23824327
MIRT619114	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT619113	hsa-miR-5698	HITS-CLIP	23824327
MIRT619112	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT619111	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT619110	hsa-miR-4525	HITS-CLIP	23824327
MIRT619109	hsa-miR-5010-5p	HITS-CLIP	23824327
MIRT619108	hsa-miR-1275	HITS-CLIP	23824327
MIRT619107	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT619130	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619129	hsa-miR-4499	HITS-CLIP	23824327
MIRT619128	hsa-miR-9500	HITS-CLIP	23824327
MIRT619127	hsa-miR-637	HITS-CLIP	23824327
MIRT619126	hsa-miR-4513	HITS-CLIP	23824327
MIRT619125	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT619124	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT619123	hsa-miR-6077	HITS-CLIP	23824327
MIRT619122	hsa-miR-1249-5p	HITS-CLIP	23824327
MIRT619121	hsa-miR-6797-5p	HITS-CLIP	23824327
MIRT619120	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT619119	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT619118	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT619117	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT619116	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT619115	hsa-miR-625-5p	HITS-CLIP	23824327
MIRT619114	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT619113	hsa-miR-5698	HITS-CLIP	23824327
MIRT619112	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT619111	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT619110	hsa-miR-4525	HITS-CLIP	23824327
MIRT619109	hsa-miR-5010-5p	HITS-CLIP	23824327
MIRT619108	hsa-miR-1275	HITS-CLIP	23824327
MIRT619107	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT663020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT663020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT663020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT663023	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT663023	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT663023	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT663024	hsa-miR-5681a	HITS-CLIP	23824327
MIRT663023	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT663022	hsa-miR-3152-3p	HITS-CLIP	23824327
MIRT663021	hsa-miR-4455	HITS-CLIP	23824327
MIRT663020	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619130	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619129	hsa-miR-4499	HITS-CLIP	23824327
MIRT619128	hsa-miR-9500	HITS-CLIP	23824327
MIRT619127	hsa-miR-637	HITS-CLIP	23824327
MIRT619126	hsa-miR-4513	HITS-CLIP	23824327
MIRT619125	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT619124	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT619123	hsa-miR-6077	HITS-CLIP	23824327
MIRT619122	hsa-miR-1249-5p	HITS-CLIP	23824327
MIRT619121	hsa-miR-6797-5p	HITS-CLIP	23824327
MIRT619120	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT619119	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT619118	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT619117	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT619116	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT619115	hsa-miR-625-5p	HITS-CLIP	23824327
MIRT619114	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT619113	hsa-miR-5698	HITS-CLIP	23824327
MIRT619112	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT619111	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT619110	hsa-miR-4525	HITS-CLIP	23824327
MIRT619109	hsa-miR-5010-5p	HITS-CLIP	23824327
MIRT619108	hsa-miR-1275	HITS-CLIP	23824327
MIRT619107	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT619130	hsa-miR-888-3p	HITS-CLIP	23824327
MIRT619129	hsa-miR-4499	HITS-CLIP	23824327
MIRT619128	hsa-miR-9500	HITS-CLIP	23824327
MIRT619127	hsa-miR-637	HITS-CLIP	23824327
MIRT619126	hsa-miR-4513	HITS-CLIP	23824327
MIRT619125	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT619124	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT619123	hsa-miR-6077	HITS-CLIP	23824327
MIRT619122	hsa-miR-1249-5p	HITS-CLIP	23824327
MIRT619121	hsa-miR-6797-5p	HITS-CLIP	23824327
MIRT619120	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT619119	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT619118	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT619117	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT619116	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT619115	hsa-miR-625-5p	HITS-CLIP	23824327
MIRT619114	hsa-miR-4723-5p	HITS-CLIP	23824327
MIRT619113	hsa-miR-5698	HITS-CLIP	23824327
MIRT619112	hsa-miR-6870-5p	HITS-CLIP	23824327
MIRT619111	hsa-miR-7111-5p	HITS-CLIP	23824327
MIRT619110	hsa-miR-4525	HITS-CLIP	23824327
MIRT619109	hsa-miR-5010-5p	HITS-CLIP	23824327
MIRT619108	hsa-miR-1275	HITS-CLIP	23824327
MIRT619107	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT875381	hsa-miR-1205	CLIP-seq
MIRT875382	hsa-miR-1273f	CLIP-seq
MIRT875383	hsa-miR-185	CLIP-seq
MIRT875384	hsa-miR-3123	CLIP-seq
MIRT875385	hsa-miR-3170	CLIP-seq
MIRT875386	hsa-miR-326	CLIP-seq
MIRT875387	hsa-miR-330-5p	CLIP-seq
MIRT875388	hsa-miR-338-5p	CLIP-seq
MIRT875389	hsa-miR-346	CLIP-seq
MIRT875390	hsa-miR-3665	CLIP-seq
MIRT875391	hsa-miR-3927	CLIP-seq
MIRT875392	hsa-miR-3935	CLIP-seq
MIRT875393	hsa-miR-4288	CLIP-seq
MIRT875394	hsa-miR-4306	CLIP-seq
MIRT875395	hsa-miR-4311	CLIP-seq
MIRT875396	hsa-miR-4418	CLIP-seq
MIRT875397	hsa-miR-4534	CLIP-seq
MIRT875398	hsa-miR-4644	CLIP-seq
MIRT875399	hsa-miR-4666-3p	CLIP-seq
MIRT875400	hsa-miR-4711-5p	CLIP-seq
MIRT875401	hsa-miR-4764-5p	CLIP-seq
MIRT875402	hsa-miR-4766-5p	CLIP-seq
MIRT875403	hsa-miR-4782-5p	CLIP-seq
MIRT875404	hsa-miR-488	CLIP-seq
MIRT875405	hsa-miR-509-3-5p	CLIP-seq
MIRT875406	hsa-miR-509-5p	CLIP-seq
MIRT875407	hsa-miR-515-5p	CLIP-seq
MIRT875408	hsa-miR-632	CLIP-seq
MIRT875409	hsa-miR-654-3p	CLIP-seq
MIRT875410	hsa-miR-657	CLIP-seq
MIRT875382	hsa-miR-1273f	CLIP-seq
MIRT875383	hsa-miR-185	CLIP-seq
MIRT1959521	hsa-miR-3607-5p	CLIP-seq
MIRT1959522	hsa-miR-3661	CLIP-seq
MIRT875394	hsa-miR-4306	CLIP-seq
MIRT875395	hsa-miR-4311	CLIP-seq
MIRT1959523	hsa-miR-4501	CLIP-seq
MIRT875397	hsa-miR-4534	CLIP-seq
MIRT875398	hsa-miR-4644	CLIP-seq
MIRT875407	hsa-miR-515-5p	CLIP-seq
MIRT1959524	hsa-miR-631	CLIP-seq
MIRT1959525	hsa-miR-659	CLIP-seq
MIRT875382	hsa-miR-1273f	CLIP-seq
MIRT875383	hsa-miR-185	CLIP-seq
MIRT2196504	hsa-miR-1908	CLIP-seq
MIRT875394	hsa-miR-4306	CLIP-seq
MIRT875395	hsa-miR-4311	CLIP-seq
MIRT875397	hsa-miR-4534	CLIP-seq
MIRT875398	hsa-miR-4644	CLIP-seq
MIRT875407	hsa-miR-515-5p	CLIP-seq
MIRT2196505	hsa-miR-663	CLIP-seq
MIRT875407	hsa-miR-515-5p	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
FOS	Unknown	11160303
GATA3	Activation	18719603
JUND	Unknown	11160303
NFKB1	Activation	11751888
NFKB1	Unknown	11160303;11529914;21243522
REL	Unknown	11160303
RELA	Unknown	11160303;11529914;21243522
STAT1	Activation	12855573

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	9468137
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005174	Function	CD40 receptor binding	IMP	31331973
GO:0005174	Function	CD40 receptor binding	IPI	9468137
GO:0005178	Function	Integrin binding	IMP	31331973
GO:0005515	Function	Protein binding	IPI	15067037, 31331973
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9468137
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7678552
GO:0006954	Process	Inflammatory response	IDA	9468137
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	NAS	9468137
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	31331973
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	15067037
GO:0009986	Component	Cell surface	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9468137
GO:0023035	Process	CD40 signaling pathway	IDA	8910514, 15708970
GO:0023035	Process	CD40 signaling pathway	IDA	1280226
GO:0023035	Process	CD40 signaling pathway	IMP	31331973
GO:0023052	Process	Signaling	IEA
GO:0030168	Process	Platelet activation	IDA	9468137
GO:0030183	Process	B cell differentiation	IEA
GO:0031295	Process	T cell costimulation	TAS	8617933
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	8617933
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	9922218
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	8617933
GO:0042100	Process	B cell proliferation	IDA	8605945
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	8617933
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12697681
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	15067037
GO:0045190	Process	Isotype switching	IEA
GO:0045190	Process	Isotype switching	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15067037
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	12885753
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA

MIM	HGNC	e!Ensembl
300386	11935	ENSG00000102245

P29965

Protein name

CD40 ligand (CD40-L) (T-cell antigen Gp39) (TNF-related activation protein) (TRAP) (Tumor necrosis factor ligand superfamily member 5) (CD antigen CD154) [Cleaved into: CD40 ligand, membrane form; CD40 ligand, soluble form (sCD40L)]

Protein function

Cytokine that acts as a ligand to CD40/TNFRSF5 (PubMed:1280226, PubMed:31331973). Costimulates T-cell proliferation and cytokine production (PubMed:8617933). Its cross-linking on T-cells generates a costimulatory signal which enhances the produc

PDB

1ALY , 1I9R , 3LKJ , 3QD6 , 6BRB , 6W9G , 7SGM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	138 → 261	TNF(Tumour Necrosis Factor) family	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed on activated CD4+ T-lymphocytes.

Sequence

MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction NF-kappa B signaling pathway Cell adhesion molecules T cell receptor signaling pathway Intestinal immune network for IgA production Malaria Toxoplasmosis Asthma Autoimmune thyroid disease Systemic lupus erythematosus Allograft rejection Primary immunodeficiency Viral myocarditis Lipid and atherosclerosis		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

246

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Common variable immunodeficiency	Likely pathogenic	rs1569376229	RCV003493731
Hyper-IgM syndrome type 1	Likely pathogenic; Pathogenic	rs2148552406, rs2148550523, rs2148552407, rs2148552412, rs2148553684, rs2148551084, rs767889061, rs2148552941, rs2148552379, rs2148553738, rs1215852570, rs2148550585, rs2522106494, rs144855738, rs2148551102 View all (52 more)	RCV001379720 RCV001384131 RCV001387581 RCV001382556 RCV001382557 RCV004819198 RCV001955839 RCV001897038 RCV001954712 RCV001925891 RCV001935283 RCV001895461 RCV002468418 RCV003066380 RCV003066381 RCV003066382 RCV003066383 RCV003066384 RCV003041484 RCV002823843 RCV002823885 RCV002834387 RCV002899648 RCV002927819 RCV003015911 RCV003023907 RCV003023948 RCV003140603 RCV003142255 RCV003228759 RCV002518747 RCV000011907 RCV000011909 RCV000011910 RCV000011912 RCV000011913 RCV000011914 RCV000011918 RCV000011919 RCV003314341 RCV003513701 RCV003511598 RCV003512468 RCV003622715 RCV003622250 RCV001378166 RCV001865515 RCV000606199 RCV000029463 RCV000029464 RCV000029466 RCV003512068 RCV000636648 RCV000685846 RCV000689441 RCV003987683 RCV000781202 RCV000803202 RCV000805406 RCV000818235 RCV001030051 RCV001049523 RCV001070147 RCV001066545 RCV001060070 RCV001060218 RCV001203125 RCV001236186 RCV001226556 RCV001237589 RCV001253461 RCV001264504
Hyperimmunoglobulin M syndrome	Pathogenic	rs2076118841	RCV001193392
Nonpapillary renal cell carcinoma	Likely pathogenic	rs2148552406	RCV005912621

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	no classification for the single variant	rs104894773, rs104894772	-
CD40LG-related disorder	Benign; Likely benign	rs778398894, rs751481337, rs371664032, rs11575983, rs199914973	RCV003900760 RCV003954324 RCV003922079 RCV003960288 RCV003895671

Show/Hide Text Mining Associations (341)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondroplasia and Swiss type agammaglobulinemia	Associate	8097258
Acidosis	Associate	23144702
Acute Coronary Syndrome	Associate	11711459, 31183392, 34239024
Acute Coronary Syndrome	Stimulate	14769218
Acute Disease	Associate	20978895, 21733938
Adenocarcinoma	Associate	36307410
Adenocarcinoma of Lung	Associate	23994887, 38011277
Alcoholism	Stimulate	35371104
Allergic Fungal Sinusitis	Associate	37325657
Alzheimer Disease	Stimulate	9394977
Angina Stable	Associate	11711459
Angina Unstable	Associate	11711459, 34239024
Anthropophobia	Stimulate	34831335
Antiphospholipid Syndrome	Associate	11535526, 34114358
Aortic Aneurysm Abdominal	Associate	14743151
Arteriosclerosis	Associate	11069068
Arthritis	Associate	10366125
Arthritis Infectious	Associate	18945879
Arthritis Juvenile	Associate	10366125
Arthritis Psoriatic	Associate	24676037
Arthritis Rheumatoid	Associate	10366125, 10700427, 10886401, 11056676, 15248214, 16736517, 17845713, 24742142, 28837666, 30402903, 9410920
Arthritis Rheumatoid	Stimulate	11905840, 24019115
Asthma	Associate	30864351, 34714718
Atherosclerosis	Associate	10623647, 11985663, 14607202, 14769218, 15467191, 17543638, 21733938, 22440854, 23166616, 23561892, 25970603, 26719354, 33406736, 9050882, 9285647
Atrial Fibrillation	Associate	17901373, 22992131
Atrial Fibrillation	Stimulate	29374968
Atypical Hemolytic Uremic Syndrome	Associate	18268093
Atypical Squamous Cells of the Cervix	Associate	37970926
Autistic Disorder	Stimulate	28070266
Autoimmune Diseases	Associate	12115186, 12509450, 17562816, 17845713, 20026377, 23092922, 27391025, 31616406
Autoimmune Diseases of the Nervous System	Associate	11905840
Bacterial Infections	Associate	11369571
Bare lymphocyte syndrome 2	Associate	9521069
Behcet Syndrome	Associate	29052524
Bile and Pancreatic Ducts Complete Absence of	Stimulate	33180184
Biliary Tract Diseases	Associate	21103345
Blood Platelet Disorders	Associate	32709752
Bone Diseases	Associate	16736517
Bone Marrow Failure Disorders	Associate	17805323
Brain Ischemia	Associate	21733938
Breast Neoplasms	Associate	16794829, 23934044, 25992978
Breast Neoplasms	Stimulate	19400944
Bronchiolitis Obliterans Syndrome	Associate	23607447
Bruton type agammaglobulinemia	Associate	26873735
Burkitt Lymphoma	Associate	11964311, 17709483, 7595225, 9763568
Buruli Ulcer	Associate	28241036
Carcinoma Hepatocellular	Associate	23825554, 38548267
Carcinoma Ovarian Epithelial	Associate	11950960
Carcinoma Pancreatic Ductal	Associate	33180184, 39256468
Carcinoma Renal Cell	Associate	11472395, 34445576, 9030857
Carcinoma Squamous Cell	Associate	37177979
Carcinoma Transitional Cell	Associate	12592374
Cardiovascular Diseases	Associate	17543638, 24358353
Cardiovascular Diseases	Stimulate	27992360
Carnitine palmitoyl transferase 2 deficiency	Associate	35572607
Carotid Stenosis	Associate	23561892
Cellulitis	Associate	33609379
Central Nervous System Diseases	Associate	11839576
Cerebral Arterial Diseases	Stimulate	21733938
Cerebral Infarction	Associate	17901373, 23561892
Cerebrovascular Disorders	Associate	26719354
Cholangiocarcinoma	Associate	21103345
Cholangiocarcinoma	Stimulate	33180184
Chronic Periodontitis	Stimulate	32345091
Cognition Disorders	Associate	20631174, 23555843
Colitis Ulcerative	Associate	16149136, 32141817
Colonic Diseases	Associate	12970138
Colorectal Neoplasms	Associate	29155517, 33180184
Common Variable Immunodeficiency	Associate	11520777, 17893433, 20652909, 35570134, 9246212, 9933119
Common Variable Immunodeficiency	Inhibit	7508119
Communicable Diseases	Associate	33495902
Coronary Artery Disease	Stimulate	21889313
Coronary Artery Disease	Associate	22645426, 27525421
Coronary Disease	Associate	28796044
COVID 19	Associate	33260035, 34504502
Crohn Disease	Associate	33298614
Cryptococcosis	Associate	30447657
Cystic Fibrosis	Associate	25742660, 28030642
Cytokine Release Syndrome	Associate	18714535
Cytokine Release Syndrome	Stimulate	31382872
Cytomegalovirus Infections	Associate	24594993
Death	Associate	22295117, 25422398
Dental Plaque	Associate	10623647
Depressive Disorder Major	Associate	33479350
Dermatitis	Associate	33481042
Dermatitis Atopic	Associate	28821884
Diabetes Mellitus	Stimulate	19755790
Diabetic Angiopathies	Associate	15708899
Diabetic Nephropathies	Associate	38027201
digital ulcers	Associate	15708899
Disease	Associate	9394977
DNA Virus Infections	Stimulate	29565449
Down Syndrome	Associate	25222269, 27293319
Drug Hypersensitivity	Associate	23521868, 28939410
Dysgammaglobulinemia	Associate	19903677
Embolism Fat	Associate	28696349
Encephalitis	Associate	29245273
Encephalitis Tick Borne	Stimulate	31924650
Encephalitis Viral	Associate	11839576, 20631174
Endometrial Neoplasms	Associate	34158412
Enteritis	Associate	11369571
Eosinophilia	Associate	36808635
Epstein Barr Virus Infections	Stimulate	12805559
Erythema elevatum diutinum	Stimulate	29052524
Esophageal Squamous Cell Carcinoma	Associate	27630283
Fatigue Syndrome Chronic	Associate	29223146
Fatty Liver	Associate	29985430
Gastrointestinal Neoplasms	Associate	33180184
Genetic Diseases X Linked	Associate	7681587
Glioblastoma	Associate	29244745
Glomerulonephritis	Associate	20506525
Glomerulonephritis IGA	Associate	8973620
Graft vs Host Disease	Associate	16792671
Graves Disease	Inhibit	15147360
Graves Disease	Associate	27612658
Graves Ophthalmopathy	Associate	19117935, 25653477, 27612658, 9792671
Guillain Barre Syndrome	Associate	37221406
Hashimoto Disease	Inhibit	15147360
Head and Neck Neoplasms	Associate	32917280
Heart Diseases	Associate	21177803
Heart Failure	Stimulate	14607202
Heart Failure	Associate	18086125
Heat Exhaustion	Stimulate	33479350
Hepatitis B	Associate	10520003
Hepatitis C Chronic	Associate	17634507
Hereditary leiomyomatosis and renal cell cancer	Associate	11815953, 7522624
HIV Infections	Associate	10337023, 11687447, 11902332, 12730375, 15231570, 20631174, 20886040, 20926955, 21177803, 21985367, 23555843, 24594993, 24924152, 27321752, 33008839, 35738253, 9521075 View all (2 more)
HIV Infections	Stimulate	14517079
HIV Infections	Inhibit	7586672
Hodgkin Disease	Associate	11815953, 7522624, 7573367, 9746758
Hodgkin Disease	Stimulate	21114485
HTLV I Infections	Associate	11287580, 17258259
Humoral Hypercalcemia Of Malignancy	Associate	7586672
Huntington Disease	Associate	10090942
Hyper IgM Immunodeficiency Syndrome	Associate	10366125, 12656310, 15997875, 17562816, 20652909, 23010537, 29675019, 36532052, 7523449, 7532185, 8550833, 8589998, 9030857, 9933119
Hyper IgM Immunodeficiency Syndrome Type 1	Associate	10207167, 10366125, 10640744, 10931152, 11073939, 11158612, 11270473, 11675497, 12805559, 12823286, 12840068, 14514918, 14641931, 14663287, 15358621 View all (36 more)
Hyper IgM Immunodeficiency Syndrome Type 1	Inhibit	17244160, 21967264, 9842907
Hypercholesterolemia	Associate	15629370, 17388962
Hypercholesterolemia due to arg3500 mutation of Apo B 100	Inhibit	14641931, 21958324, 35443026
Hypercholesterolemia due to arg3500 mutation of Apo B 100	Associate	21958324
Hypereosinophilic Syndrome	Associate	37325657
Hypergammaglobulinemia	Associate	9808566
Hyperglycemia	Stimulate	17127486
Hyperhomocysteinemia	Associate	17543638
Hyperinsulinism	Stimulate	17127486
Hyperkinesis	Associate	35267244
Hyperlipoproteinemia Type II	Associate	12535822
Hyperlipoproteinemia Type II	Stimulate	17388962
Hypertension	Associate	30864351
Hypertrophy	Stimulate	37409959
Hypoadiponectinemia	Associate	18349065
Hypoxia	Associate	22295117
Idiopathic Pulmonary Fibrosis	Associate	37266442
IgA Vasculitis	Associate	11905840, 12699431
IgG Deficiency	Associate	19903677
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	23223361
Immune System Diseases	Associate	10337023, 16099873, 37197664
Immunoglobulin a deficiency 1	Associate	27800605
Immunoglobulin G4 Related Disease	Associate	22824292
Immunologic Deficiency Syndromes	Associate	11687447, 20652909, 20702779, 21898485, 27800605, 33764006, 9933119
Infarction	Associate	11711459
Infarction	Stimulate	23561892
Infections	Associate	10931140, 14641931, 17392362, 28727807, 33495902
Inferior Wall Myocardial Infarction	Associate	23561892
Inflammation	Associate	10931140, 11238037, 11493450, 11711459, 11839576, 11905840, 12207328, 12970138, 14607202, 15130939, 15248214, 15315968, 15467191, 15539085, 15939744 View all (41 more)
Inflammation	Stimulate	18714535
Inflammatory Bowel Diseases	Associate	12970136, 37918715
Inflammatory Breast Neoplasms	Associate	18248671
Influenza Human	Associate	22715399, 28017428, 35494526
Interleukin 2 Receptor Alpha Deficiency of	Inhibit	7508119
Intracranial Aneurysm	Associate	29115560
Intracranial Arteriosclerosis	Associate	23561892
Invasive Pulmonary Aspergillosis	Associate	22731696
Ischemic Stroke	Stimulate	21733938
Job Syndrome	Associate	37916874
Keloid	Stimulate	36012134
Klinefelter Syndrome	Stimulate	31069824
Latent Tuberculosis	Stimulate	25520147
Leishmaniasis	Associate	35572607
Leishmaniasis Cutaneous	Associate	15716079
Leprosy	Associate	10903757, 34695167
Leprosy Tuberculoid	Associate	10903757
Leukemia	Associate	10477734, 11049967, 12176885, 15295005, 16413390, 20882050, 22139839, 9486984
Leukemia	Inhibit	11175813, 16741250
Leukemia B Cell	Associate	17392362
Leukemia Large Granular Lymphocytic	Associate	10887130
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 10520003, 11049967, 11435295, 11981828, 12176885, 12176902, 12377186, 14662328, 15471955, 15536147, 15914559, 16179374, 16391015, 16741250 View all (28 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	24990888
Leukemia Lymphocytic Chronic B Cell	Inhibit	35149845
Leukemia Lymphoid	Associate	7913843
Leukemia Lymphoma Adult T Cell	Associate	11902332, 27391025, 7573367
Leukemia Lymphoma Adult T Cell	Inhibit	17258259
Leukemia Monocytic Acute	Associate	27992360
Leukemia Myeloid	Associate	15958635
Leukemia Myeloid Acute	Associate	21520003
Leukemia Prolymphocytic T Cell	Associate	29767411, 35655388, 37528310, 9450802, 9792321
Leukemia T Cell	Associate	38233409
Light Fixation Seizure Syndrome	Associate	15358621, 16103163, 17244160, 29245273, 32538998, 33743629, 36419145, 36808635, 8097258, 8914765
Livedo Reticularis	Associate	14962968
Liver Cirrhosis	Associate	11369571
Liver Cirrhosis Biliary	Associate	21898485
Liver Failure	Associate	34551597
Lung Diseases	Associate	28030642
Lung Diseases Interstitial	Associate	12656310
Lung Neoplasms	Associate	28187172, 29565449
Lupus Erythematosus Systemic	Associate	10323442, 10510335, 11086108, 11226290, 11905840, 14962968, 16126793, 16221206, 17237447, 19180486, 19919693, 22952582, 23434382, 24117612, 24500400 View all (16 more)
Lupus Erythematosus Systemic	Stimulate	17469136, 17947713, 19520616, 20506525, 23029299, 25098715, 26395317
Lupus Nephritis	Associate	15693003, 18285351, 20506525
Lymphoma	Associate	10595932, 10979969, 11825564, 14511234, 16099873, 18287517, 9358761
Lymphoma	Inhibit	23072591
Lymphoma B Cell	Associate	11815953, 16099873, 7573367, 7742541, 9792321
Lymphoma Follicular	Associate	18287517, 18606651, 22015774, 23686488, 7573367, 9858217
Lymphoma Mantle Cell	Associate	10979969, 25797245, 9792311
Lymphoma Non Hodgkin	Associate	17456057, 7573367, 7913843, 8541553
Lymphoma T Cell	Associate	38233409, 7573367, 9767448
Lymphoproliferative Disorders	Associate	21543760
Lymphoproliferative Disorders	Stimulate	30823870
Lymphoproliferative Syndrome X Linked 2	Associate	21543760, 7533792
Macular Degeneration	Associate	29454857
Malaria	Associate	23144702, 23614351
Malocclusion Angle Class II	Associate	9521069
Mastocytosis Systemic	Inhibit	29223146
Melanoma	Associate	23867552, 28427434, 30963193, 32246006, 32591862, 8952530
Metabolic Syndrome	Stimulate	18349065
Mitral Valve Stenosis	Associate	22992131
Movement Disorders	Associate	35267244
Mucocutaneous Lymph Node Syndrome	Associate	22645426, 27525421
Multiple Myeloma	Associate	11495701, 12139739, 29089645
Multiple Sclerosis	Stimulate	10736102
Multiple Sclerosis	Associate	11839576, 24751386, 31039804, 36250467, 9012830
Multiple Sclerosis Chronic Progressive	Associate	39613182
Muscular Diseases	Associate	35572607
Myasthenia Gravis	Inhibit	25893403
Mycobacterium Infections Nontuberculous	Associate	25742660
Mycosis Fungoides	Associate	12689942, 8541553
Myelodysplastic Syndromes	Associate	15103504, 17805323
Myocardial Infarction	Associate	11985663, 17901373, 20978895, 23166616
Nasopharyngeal Carcinoma	Associate	36438903
Necrosis	Associate	22295117
Neoplasms	Associate	11169447, 12805559, 13680192, 14557622, 14581487, 15315967, 16175400, 16794829, 17487280, 17709483, 20072155, 22692727, 22893706, 23686488, 24741998 View all (19 more)
Neoplasms	Inhibit	32591862
Neoplasms	Stimulate	33180184, 37500773, 7913843
Neoplasms Squamous Cell	Associate	7913843
Nephritis	Stimulate	20506525
Nephritis Interstitial	Associate	18285351
Nephrotic Syndrome	Associate	31352232
Neural Tube Defects	Associate	21958324
Neuroblastoma	Associate	28687069
Neurodegenerative Diseases	Associate	35267244
Neuroinflammatory Diseases	Associate	17918746, 20631174
Neurologic Manifestations	Associate	23561892
Neuromyelitis Optica	Associate	39226901
Neutropenia	Associate	36808635, 8669967, 9030857
Obesity	Associate	35219585
Oculocerebrorenal Syndrome	Associate	19755790
Ovarian Neoplasms	Associate	17565609
Pancreatic Neoplasms	Stimulate	33180184
Pancreatitis	Associate	33180184
Paracoccidioidomycosis	Associate	31572394
Paraparesis Tropical Spastic	Associate	11902332
Paraparesis Tropical Spastic	Inhibit	17258259
Peanut Hypersensitivity	Stimulate	29408715
Peanut Hypersensitivity	Associate	31654649, 34813505
Pemphigus	Associate	36203615
Periodic fever familial autosomal dominant	Associate	14557622
Pituitary Neoplasms	Associate	35202564
Plaque Atherosclerotic	Associate	11238037, 14769218, 23561892
Pneumonia	Associate	23010537
Pneumonia Pneumocystis	Associate	33495902
Pneumothorax	Associate	23010537
Polyps	Associate	27468819
Pouchitis	Associate	16149136
Pre Eclampsia	Associate	19221099
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10477734, 17378240, 27391025, 8652829
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11472395, 38233409
Preeclamptic toxemia	Stimulate	19221099
Primary Immunodeficiency Diseases	Associate	21543760, 26162572, 30131802
Progressive hearing loss stapes fixation	Associate	35202564
Prostatic Neoplasms	Associate	21379379
Pseudomonas Infections	Associate	28030642
Pulmonary Alveolar Proteinosis	Associate	37173671
Pulmonary Arterial Hypertension	Associate	15708899
Pulmonary Disease Chronic Obstructive	Associate	16135718, 33260035
Purpura Thrombocytopenic	Associate	26183367
Purpura Thrombocytopenic Idiopathic	Stimulate	15191945
Purpura Thrombocytopenic Idiopathic	Associate	17654056, 26183367, 28419421
Pyoderma Gangrenosum	Associate	24903614, 28518224
Pyoderma Gangrenosum	Stimulate	25501066
Radiation Pneumonitis	Associate	33109238
Recombinant chromosome 8 syndrome	Associate	18824584
Renal cell carcinoma 1	Inhibit	7717401
Renal Insufficiency	Stimulate	38581334
Renal Insufficiency Chronic	Stimulate	14976397, 27992360
Respiratory Distress Syndrome	Associate	23144702, 35804376
Respiratory Tract Infections	Associate	37173671
Retinal Diseases	Associate	29454857
Rheumatic Diseases	Associate	26183367
Rhinitis Allergic	Inhibit	33626956
Rhinitis Allergic Perennial	Stimulate	9119992
Rhinitis Allergic Seasonal	Associate	24834772
Sarcoidosis	Inhibit	21177920
Sarcoidosis	Associate	34534436
Sarcoma	Associate	30963193
Sarcoma Kaposi	Stimulate	33799006
Scabies	Stimulate	9394977
Scleroderma Systemic	Associate	15708899
Scleroderma Systemic	Stimulate	22231486, 26584613
Sepsis	Inhibit	18945879
Severe Combined Immunodeficiency	Associate	33743629
Sexual Dysfunction Physiological	Associate	28623282
Sezary Syndrome	Associate	15315967
Sialadenitis	Associate	10340964
Sjogren's Syndrome	Associate	10340964, 11876766, 12472667, 33407802
Sjogren's Syndrome	Stimulate	24117612
Sjogren's Syndrome	Inhibit	27461134
Skin Manifestations	Associate	20026377
Sleep Apnea Obstructive	Associate	32036486, 34239024
Spondylarthropathies	Associate	15743484
Squamous Cell Carcinoma of Head and Neck	Associate	33134377, 36268020
Stomach Neoplasms	Associate	19865524
Stroke	Stimulate	19755790, 21733938, 21767237
Synovitis	Associate	9410920
T cell immunodeficiency primary	Associate	7508119
talaromycosis	Associate	31572394
Thrombosis	Associate	11493450, 14607202, 15315968, 17388962, 18086125, 20978895, 22992131, 37409530
Thyroid Cancer Papillary	Associate	36438899
Thyroiditis Autoimmune	Associate	15147360
Transfusion Reaction	Associate	25430087
Tuberculosis	Stimulate	21186260
Tuberculosis Meningeal	Associate	22961735
Tuberculosis Pleural	Associate	21625607
Turner Syndrome	Associate	31069824
Urinary Bladder Neoplasms	Associate	12592374
Uterine Cervical Neoplasms	Associate	37970926
Uveitis Anterior	Stimulate	15948793
Vascular Diseases	Associate	11985663
Vascular System Injuries	Associate	10623647
Vasculitis	Associate	27525421
Venous Thromboembolism	Associate	17408407
Waldenstrom Macroglobulinemia	Associate	16317092
X Linked Combined Immunodeficiency Diseases	Associate	21543760, 22039266, 7532185

CD40LG (CD40 ligand)