Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	9572
Gene name	Nuclear receptor subfamily 1 group D member 1
Gene symbol	NR1D1
Synonyms (NCBI Gene)	EAR1REVERBAREVERBalphaTHRA1THRALear-1hRev
Chromosome	17
Chromosome location	17q21.1
Summary	This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein repre

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017335	hsa-miR-335-5p	Microarray	18185580
MIRT1191990	hsa-miR-1266	CLIP-seq
MIRT1191991	hsa-miR-24	CLIP-seq
MIRT1191992	hsa-miR-4518	CLIP-seq
MIRT1191993	hsa-miR-4678	CLIP-seq
MIRT1191994	hsa-miR-4699-3p	CLIP-seq
MIRT1191995	hsa-miR-4736	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582396	hsa-miR-1275	CLIP-seq
MIRT2582397	hsa-miR-140-5p	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2582398	hsa-miR-299-5p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2582399	hsa-miR-3175	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2582400	hsa-miR-4525	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2582401	hsa-miR-4665-5p	CLIP-seq
MIRT2582402	hsa-miR-4723-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2582403	hsa-miR-4797-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582404	hsa-miR-625	CLIP-seq
MIRT2582405	hsa-miR-759	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RORA	Activation	22024429

106

Show/Hide all (106)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19955433
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8622974
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18511497
GO:0000785	Component	Chromatin	IDA	18511497
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18511497
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19955433
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15761026
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	8622974
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IDA	15761026
GO:0001222	Function	Transcription corepressor binding	IMP	18006707
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8622974
GO:0001678	Process	Intracellular glucose homeostasis	IMP	18006707
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	1971514
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	TAS	8622974
GO:0005515	Function	Protein binding	IPI	17892483, 20534529, 20581824, 21874017, 22170608, 23398316, 24311788, 24737000, 26392558, 26871637, 27238018, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	8622974
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0005978	Process	Glycogen biosynthetic process	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IEA
GO:0010498	Process	Proteasomal protein catabolic process	ISS
GO:0016604	Component	Nuclear body	IDA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0020037	Function	Heme binding	IDA	18006707
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	ISS
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IMP	18511497
GO:0042632	Process	Cholesterol homeostasis	IDA	18511497
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042749	Process	Regulation of circadian sleep/wake cycle	IEA
GO:0042749	Process	Regulation of circadian sleep/wake cycle	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044321	Process	Response to leptin	IBA
GO:0044321	Process	Response to leptin	IEA
GO:0044321	Process	Response to leptin	ISS
GO:0045202	Component	Synapse	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15761026, 20070857, 23398316
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18006707, 21628546
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0060086	Process	Circadian temperature homeostasis	IEA
GO:0060086	Process	Circadian temperature homeostasis	ISS
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0061889	Process	Negative regulation of astrocyte activation	IEA
GO:0061889	Process	Negative regulation of astrocyte activation	ISS
GO:0070859	Process	Positive regulation of bile acid biosynthetic process	IEA
GO:0070859	Process	Positive regulation of bile acid biosynthetic process	ISS
GO:0070888	Function	E-box binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	18511497
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24162845
GO:0150079	Process	Negative regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:1903979	Process	Negative regulation of microglial cell activation	IEA
GO:1903979	Process	Negative regulation of microglial cell activation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602408	7962	ENSG00000126368

P20393

Protein name

Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)

Protein function

Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of th

PDB

1A6Y , 1GA5 , 1HLZ , 3N00 , 8D8I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	130 → 200	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	434 → 611	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Also expressed in endothelial cells (ECs), vascular smooth muscle cells (VSMCs) and macrophages. Expression oscillates diurnally in the

Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ

Sequence length

614

Interactions

View interactions

	KEGG		Reactome
	Circadian rhythm		PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Nuclear Receptor transcription pathway Circadian Clock

NR1D1 (nuclear receptor subfamily 1 group D member 1)