Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9572
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 1 group D member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR1D1
Synonyms (NCBI Gene) Gene synonyms aliases
EAR1, REVERBA, REVERBalpha, THRA1, THRAL, ear-1, hRev
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein repre
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017335 hsa-miR-335-5p Microarray 18185580
MIRT1191990 hsa-miR-1266 CLIP-seq
MIRT1191991 hsa-miR-24 CLIP-seq
MIRT1191992 hsa-miR-4518 CLIP-seq
MIRT1191993 hsa-miR-4678 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
RORA Activation 22024429
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 19955433
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 8622974
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18511497
GO:0000785 Component Chromatin IDA 18511497
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602408 7962 ENSG00000126368
Protein
UniProt ID P20393
Protein name Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
Protein function Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of th
PDB 1A6Y , 1GA5 , 1HLZ , 3N00 , 8D8I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 130 200 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 434 611 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Also expressed in endothelial cells (ECs), vascular smooth muscle cells (VSMCs) and macrophages. Expression oscillates diurnally in the
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSR
DAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRV
DAQ
Sequence length 614
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Circadian rhythm   PPARA activates gene expression
Transcriptional activation of mitochondrial biogenesis
Nuclear Receptor transcription pathway
Circadian Clock
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Inhibit 33846395
Adenocarcinoma Mucinous Associate 32533406
Bipolar Disorder Associate 21781277, 25789810
Brain Injuries Associate 37055510
Breast Neoplasms Associate 17157792, 1976118, 20160030, 26074263, 31779659, 33478016, 39193850, 9143412
Bronchopulmonary Dysplasia Associate 37478211
Carcinoma Ductal Associate 8630282
Carcinoma Lobular Associate 8630282
Carcinoma Non Small Cell Lung Associate 33846395, 35575281
Carcinoma Squamous Cell Associate 33846395, 35392800