Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9572
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear receptor subfamily 1 group D member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NR1D1
Synonyms (NCBI Gene) Gene synonyms aliases	EAR1, REVERBA, REVERBalpha, THRA1, THRAL, ear-1, hRev
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein repre

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017335	hsa-miR-335-5p	Microarray	18185580
MIRT1191990	hsa-miR-1266	CLIP-seq
MIRT1191991	hsa-miR-24	CLIP-seq
MIRT1191992	hsa-miR-4518	CLIP-seq
MIRT1191993	hsa-miR-4678	CLIP-seq
MIRT1191994	hsa-miR-4699-3p	CLIP-seq
MIRT1191995	hsa-miR-4736	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582396	hsa-miR-1275	CLIP-seq
MIRT2582397	hsa-miR-140-5p	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2582398	hsa-miR-299-5p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2582399	hsa-miR-3175	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2582400	hsa-miR-4525	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2582401	hsa-miR-4665-5p	CLIP-seq
MIRT2582402	hsa-miR-4723-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2582403	hsa-miR-4797-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq
MIRT2582404	hsa-miR-625	CLIP-seq
MIRT2582405	hsa-miR-759	CLIP-seq
MIRT2455357	hsa-miR-296-3p	CLIP-seq
MIRT2455358	hsa-miR-3151	CLIP-seq
MIRT2455359	hsa-miR-4257	CLIP-seq
MIRT2455360	hsa-miR-4265	CLIP-seq
MIRT2455361	hsa-miR-4296	CLIP-seq
MIRT2455362	hsa-miR-4322	CLIP-seq
MIRT2455363	hsa-miR-4447	CLIP-seq
MIRT2455364	hsa-miR-4472	CLIP-seq
MIRT2455365	hsa-miR-4640-5p	CLIP-seq
MIRT2455366	hsa-miR-4726-5p	CLIP-seq
MIRT2455367	hsa-miR-4728-5p	CLIP-seq
MIRT2455368	hsa-miR-491-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RORA	Activation	22024429

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8622974, 19955433
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18511497
GO:0000785	Component	Chromatin	IDA	18511497
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	18511497
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19955433
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15761026
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	8622974
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IDA	15761026
GO:0001222	Function	Transcription corepressor binding	IMP	18006707
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8622974
GO:0001678	Process	Cellular glucose homeostasis	IMP	18006707
GO:0003707	Function	Steroid hormone receptor activity	TAS	1971514
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	17892483, 20534529, 20581824, 21874017, 22170608, 23398316, 24311788, 24737000, 26392558, 26871637, 27238018, 32296183
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	ISS
GO:0005978	Process	Glycogen biosynthetic process	ISS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0007623	Process	Circadian rhythm	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA	21873635
GO:0010498	Process	Proteasomal protein catabolic process	ISS
GO:0016604	Component	Nuclear body	IDA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0020037	Function	Heme binding	IDA	18006707
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030425	Component	Dendrite	ISS
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031648	Process	Protein destabilization	ISS
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IMP	18511497
GO:0042632	Process	Cholesterol homeostasis	IDA	18511497
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042749	Process	Regulation of circadian sleep/wake cycle	ISS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043197	Component	Dendritic spine	ISS
GO:0043401	Process	Steroid hormone mediated signaling pathway	IEA
GO:0044321	Process	Response to leptin	IBA	21873635
GO:0044321	Process	Response to leptin	ISS
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15761026, 20070857, 23398316
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	18006707, 21628546
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0060086	Process	Circadian temperature homeostasis	ISS
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0061889	Process	Negative regulation of astrocyte activation	ISS
GO:0070859	Process	Positive regulation of bile acid biosynthetic process	ISS
GO:0070888	Function	E-box binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	18511497
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24162845
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:1903979	Process	Negative regulation of microglial cell activation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602408	7962	ENSG00000126368

Protein

UniProt ID

P20393

Protein name

Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)

Protein function

Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of th

PDB

1A6Y , 1GA5 , 1HLZ , 3N00 , 8D8I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	130 → 200	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	434 → 611	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Also expressed in endothelial cells (ECs), vascular smooth muscle cells (VSMCs) and macrophages. Expression oscillates diurnally in the

Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ

Sequence length

614

Interactions

View interactions

	KEGG		Reactome
	Circadian rhythm		PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Nuclear Receptor transcription pathway Circadian Clock

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Depressive disorder		22538398	ClinVar
Asthma	Asthma			GWAS
Multiple Sclerosis	Multiple Sclerosis			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	33846395
Adenocarcinoma Mucinous	Associate	32533406
Bipolar Disorder	Associate	21781277, 25789810
Brain Injuries	Associate	37055510
Breast Neoplasms	Associate	17157792, 1976118, 20160030, 26074263, 31779659, 33478016, 39193850, 9143412
Bronchopulmonary Dysplasia	Associate	37478211
Carcinoma Ductal	Associate	8630282
Carcinoma Lobular	Associate	8630282
Carcinoma Non Small Cell Lung	Associate	33846395, 35575281
Carcinoma Squamous Cell	Associate	33846395, 35392800
Cardiomyopathy Restrictive	Inhibit	35912794
Colitis Ulcerative	Associate	37154720
Colonic Neoplasms	Stimulate	35116071
Colorectal Neoplasms	Associate	35880088
Death	Stimulate	37055510
Depressive Disorder	Associate	37154720
Depressive Disorder Major	Associate	23671070
Diabetes Gestational	Associate	32517091
Hereditary Breast and Ovarian Cancer Syndrome	Associate	8460637
Inflammation	Associate	33846395, 37154720
Inflammatory Bowel Diseases	Associate	37154720
Lung Neoplasms	Associate	33846395
Lymphoma Non Hodgkin	Associate	35168293
Melanoma Cutaneous Malignant	Associate	37373286
Mental Disorders	Associate	37154720
Multiple Sclerosis	Associate	35008743
Neoplasms	Associate	17591932, 27121375, 34931925, 35168293
Neoplasms	Inhibit	9143412
Obesity	Associate	24173768, 25089907
Obesity Abdominal	Associate	24173768
Ocular Motility Disorders	Associate	34088995
Osteoarthritis	Inhibit	27884645
Osteochondrodysplasias	Associate	9463328
Ovarian Neoplasms	Associate	32533406
Progesterone Resistance	Associate	17591932
Sarcoma	Associate	35168293
Shock	Associate	36198442
Sleep Deprivation	Associate	23440187
Stomach Neoplasms	Stimulate	34162762
Triple Negative Breast Neoplasms	Associate	31779659

NR1D1 (nuclear receptor subfamily 1 group D member 1)