ATP5MF (ATP synthase membrane subunit f)

Gene

• Entrez ID: 9551
• Gene name: ATP synthase membrane subunit f
• Gene symbol: ATP5MF
• Synonyms (NCBI Gene): ATP5J2, ATP5JL
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IC	12110673
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	26297831
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006754	Process	ATP biosynthetic process	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0015986	Process	Proton motive force-driven ATP synthesis	NAS	26297831
GO:0016020	Component	Membrane	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	IBA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	IDA	12110673
GO:0045259	Component	Proton-transporting ATP synthase complex	IBA
GO:0045259	Component	Proton-transporting ATP synthase complex	IDA	12110673
GO:0045259	Component	Proton-transporting ATP synthase complex	IEA
GO:0045259	Component	Proton-transporting ATP synthase complex	NAS	11959398, 26297831
GO:0046933	Function	Proton-transporting ATP synthase activity, rotational mechanism	IBA
GO:0046933	Function	Proton-transporting ATP synthase activity, rotational mechanism	IDA	12110673
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	NAS	11959398

Other IDs

• MIM: 619792
• HGNC: 848
• e!Ensembl: ENSG00000241468

Protein

• UniProt ID: P56134
• Protein name: ATP synthase F(0) complex subunit f, mitochondrial (ATP synthase membrane subunit f)
• Protein function: Subunit f, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the resp
• PDB: 8H9F, 8H9J, 8H9M, 8H9Q, 8H9S, 8H9T, 8H9U, 8H9V, 8KHF, 8KI3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10206	WRW	12 → 90	Mitochondrial F1F0-ATP synthase, subunit f	Family

• Sequence:

  MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKK
  GSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

• Sequence length: 94

Pathways

KEGG:

Oxidative phosphorylation
Metabolic pathways
Thermogenesis

Reactome:

Formation of ATP by chemiosmotic coupling
Cristae formation