CXCL14 (C-X-C motif chemokine ligand 14)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9547
Gene name Gene Name - the full gene name approved by the HGNC.
C-X-C motif chemokine ligand 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CXCL14
Synonyms (NCBI Gene) Gene synonyms aliases
BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Mem
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(36)
miRTarBase ID miRNA Experiments Reference
MIRT739459 hsa-miR-3119 PAR-CLIP 27292025
MIRT739459 hsa-miR-3119 HITS-CLIP 27418678
MIRT739459 hsa-miR-3119 HITS-CLIP 28735896
MIRT736790 hsa-miR-582-3p Luciferase reporter assay, Western blotting, RNA-seq 33312754
MIRT917944 hsa-miR-1289 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Activation 22382027
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28381538
GO:0005615 Component Extracellular space IEA
GO:0005794 Component Golgi apparatus IDA
GO:0006935 Process Chemotaxis TAS 10049774
GO:0007165 Process Signal transduction TAS 10049774
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604186 10640 ENSG00000145824
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95715
Protein name C-X-C motif chemokine 14 (Chemokine BRAK) (MIP-2G) (Small-inducible cytokine B14)
Protein function Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. {ECO
PDB 2HDL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 35 → 99 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derive
Sequence 
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Sequence length 111
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Contact Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25724174
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 20562917
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 21150878 ClinVar
Endometriosis Endometriosis 21063030 ClinVar
Show/Hide Text Mining Associations (74)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Stimulate 38195505
Adenocarcinoma Stimulate 23597004
Adenocarcinoma of Lung Inhibit 20562917
Adenocarcinoma of Lung Associate 23597004, 32403160, 36721112
Adenomyosis Associate 38195505
Astrocytoma Associate 26497896
Brain Neoplasms Inhibit 33878734
Breast Neoplasms Associate 18765527, 23294544, 27115465, 29495008, 31117166, 35725915, 37996875
Breast Neoplasms Inhibit 24833255, 40565366
Breast Neoplasms Stimulate 28465475