CXCL14 (C-X-C motif chemokine ligand 14)

Gene

• Entrez ID: 9547
• Gene name: C-X-C motif chemokine ligand 14
• Gene symbol: CXCL14
• Synonyms (NCBI Gene): BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Mem

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT739459	hsa-miR-3119	PAR-CLIP	27292025
MIRT739459	hsa-miR-3119	HITS-CLIP	27418678
MIRT739459	hsa-miR-3119	HITS-CLIP	28735896
MIRT736790	hsa-miR-582-3p	Luciferase reporter assay, Western blotting, RNA-seq	33312754
MIRT917944	hsa-miR-1289	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917946	hsa-miR-3198	CLIP-seq
MIRT917947	hsa-miR-4252	CLIP-seq
MIRT917948	hsa-miR-4294	CLIP-seq
MIRT917949	hsa-miR-4309	CLIP-seq
MIRT917950	hsa-miR-4318	CLIP-seq
MIRT917951	hsa-miR-548v	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT1972098	hsa-miR-150	CLIP-seq
MIRT1972099	hsa-miR-204	CLIP-seq
MIRT1972100	hsa-miR-211	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT1972101	hsa-miR-4446-5p	CLIP-seq
MIRT1972102	hsa-miR-4713-5p	CLIP-seq
MIRT1972103	hsa-miR-4755-5p	CLIP-seq
MIRT1972104	hsa-miR-4780	CLIP-seq
MIRT1972105	hsa-miR-532-3p	CLIP-seq
MIRT1972106	hsa-miR-623	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT2207919	hsa-miR-3660	CLIP-seq
MIRT2207920	hsa-miR-4256	CLIP-seq
MIRT2207921	hsa-miR-4526	CLIP-seq
MIRT2207922	hsa-miR-4762-3p	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq
MIRT917945	hsa-miR-2276	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	22382027

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10049774
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10049774
GO:0007267	Process	Cell-cell signaling	TAS	10049774
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10049774
GO:0031640	Process	Killing of cells of another organism	IDA	12949249, 19109182
GO:0060326	Process	Cell chemotaxis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249, 19109182

Other IDs

• MIM: 604186
• HGNC: 10640
• e!Ensembl: ENSG00000145824

Protein

• UniProt ID: O95715
• Protein name: C-X-C motif chemokine 14 (Chemokine BRAK) (MIP-2G) (Small-inducible cytokine B14)
• Protein function: Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. {ECO
• PDB: 2HDL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	35 → 99	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derive
• Sequence:

  MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
  PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

• Sequence length: 111

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway